LXL04_037890 | RubberDandelionOmics

Gene overview

LXL04_037890

Reference: OH-1004 Chr: Chr09 Coordinates: 24463156-24467226 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_037890|LXL04_037890|OH1004|cDNA

ATGGCTGGTTTCCAATTGCAAATGACTTGGCAAACGAATTTGCTGAAGAAACGTAAGAACGGTCCTCCATTAGGGTTCAAGAATCTCGGTAATACCTGCTACCTCAACTCCGTTCTCCAGTGCTTAACCTATACTCCTCCCCTCGCCAATTTCTGTCTCCAACTTCAACACTCCCTCTCCTGCGATTCCGTGGCTCAGCAGGACAAGAAGAGTGATTGTCCGTTTTGCTTACTAGAGAAGAGAATTGTTCGATCTCTTAG...

CDS

Download CDS FASTA

1698 bp · LXL04_037890|LXL04_037890|OH1004|CDS

ATGGCTGGTTTCCAATTGCAAATGACTTGGCAAACGAATTTGCTGAAGAAACGTAAGAACGGTCCTCCATTAGGGTTCAAGAATCTCGGTAATACCTGCTACCTCAACTCCGTTCTCCAGTGCTTAACCTATACTCCTCCCCTCGCCAATTTCTGTCTCCAACTTCAACACTCCCTCTCCTGCGATTCCGTGGCTCAGCAGGACAAGAAGAGTGATTGTCCGTTTTGCTTACTAGAGAAGAGAATTGTTCGATCTCTTAG...

Protein

Download Protein FASTA

565 aa · LXL04_037890|LXL04_037890|OH1004|PROTEIN

MAGFQLQMTWQTNLLKKRKNGPPLGFKNLGNTCYLNSVLQCLTYTPPLANFCLQLQHSLSCDSVAQQDKKSDCPFCLLEKRIVRSLSIDSTLDTPGKIISGLKIFAEHFRQGRQEDAHEFLRYVIDACHTTSLRLKKLQQQRRKYVSNGGGDGVSGSTVVKEIFGGALQSQVKCLTCGNESNKVDEIMDISVDVLNSSSLKEAFQKFFQPEILDGNNKWSEIETSYLCFCSCKKLVAARKQMSIVQAPNILVIQLKRFEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037890`
TK1151 ID	TkA04G358450
OH-1004 ID	LXL04_037890
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037890

Location Chr09:24463156-24467226 (+)

Description Similar to UBP25: Ubiquitin carboxyl-terminal hydrolase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14400`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037890 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006508 proteolysis Biological Process

GO:0007000 nucleolus organization Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016242 negative regulation of macroautophagy Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0050821 protein stabilization Biological Process

GO:1901524 regulation of mitophagy Biological Process

GO:1903955 positive regulation of protein targeting to mitochondrion Biological Process

GO:2000232 regulation of rRNA processing Biological Process

KEGG gene cross-reference

ath:AT3G14400

hsa:57602

hsa:84132

mmu:72344

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.836

Rank 1 · LXL04_037890 · OH-1004

Cytoplasm0.225

Rank 2 · LXL04_037890 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_037890 · OH-1004

Mitochondrion0.041

Rank 4 · LXL04_037890 · OH-1004

Endoplasmic reticulum0.024

Rank 5 · LXL04_037890 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443.36UCH25-348 aa

PF13423.13UCH_125-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037890	`PF00443.36`	UCH	25	348	2.7e-54	185.2
LXL04_037890	`PF13423.13`	UCH_1	25	330	2.6e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPS2`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 25	68.937%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card