Gene Card
Gene overview
cDNA / CDS / Protein Sequences
477 bp · TkA04G352900|TK1151|cDNA
ATGGCATTTACACATTTACAGTGCGATTGGGTAACTGTGCACAATGATGTTTCGTGGCTAGAAGAAGGACTAGAACTGATTAGTGGTTTGCGTAGTCTTCGGGTTCTTAATCTTTCTCACAATGGGTTCGTCGGGAAATTACCGGAGAGTTTGAGTTTTTTGAAGAATTTAAATGAGGTTTCGTTGAGCAATAAGCTTTCGGGTCCTGTGTATCAGAGTTTTGTAGAGAATATTCCGGCGAACGCCGTCGTTGATCTCTC...
477 bp · TkA04G352900|TK1151|CDS
ATGGCATTTACACATTTACAGTGCGATTGGGTAACTGTGCACAATGATGTTTCGTGGCTAGAAGAAGGACTAGAACTGATTAGTGGTTTGCGTAGTCTTCGGGTTCTTAATCTTTCTCACAATGGGTTCGTCGGGAAATTACCGGAGAGTTTGAGTTTTTTGAAGAATTTAAATGAGGTTTCGTTGAGCAATAAGCTTTCGGGTCCTGTGTATCAGAGTTTTGTAGAGAATATTCCGGCGAACGCCGTCGTTGATCTCTC...
Protein
Download Protein FASTA158 aa · TkA04G352900|TK1151|PROTEIN
MAFTHLQCDWVTVHNDVSWLEEGLELISGLRSLRVLNLSHNGFVGKLPESLSFLKNLNEVSLSNKLSGPVYQSFVENIPANAVVDLSFNALTGQIPQMMSLSNQKEEYFARNLDLCGKPLKKMCRIPSSHSIPTNVSSDGSATVAEFGEVTWVLLGRR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G352900 |
|---|---|
| TK1151 ID | TkA04G352900 |
| OH-1004 ID | LXL04_037811 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 87.975 / OH-1004 48.432Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G352900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:89034116-89035062 (-) | |||||||||
| Description | Similar to At4g34220: Receptor protein kinase-like protein At4g34220 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010030 positive regulation of seed germination Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G05660 ath:AT4G34220 ath:AT4G37250 ath:AT5G40170 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13855LRR_827-64 aaPF13516LRR_631-42 aaPF00560LRR_132-54 aaPF12799LRR_432-66 aaPF00560LRR_156-67 aaPF00560LRR_184-98 aaPF12799LRR_484-95 aaPF13855LRR_884-93 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G352900 | PF13855 | LRR_8 | 27 | 64 | 0.0025 | 18.3 |
| TkA04G352900 | PF13516 | LRR_6 | 31 | 42 | 0.0064 | 17.2 |
| TkA04G352900 | PF00560 | LRR_1 | 32 | 54 | 3.6e-06 | 26.7 |
| TkA04G352900 | PF12799 | LRR_4 | 32 | 66 | 5.1e-05 | 24.1 |
| TkA04G352900 | PF00560 | LRR_1 | 56 | 67 | 3.6e-06 | 26.7 |
| TkA04G352900 | PF00560 | LRR_1 | 84 | 98 | 3.6e-06 | 26.7 |
| TkA04G352900 | PF12799 | LRR_4 | 84 | 95 | 5.1e-05 | 24.1 |
| TkA04G352900 | PF13855 | LRR_8 | 84 | 93 | 0.0025 | 18.3 |
| TkA04G352900 | PF13516 | LRR_6 | 84 | 93 | 0.0064 | 17.2 |
| TkA04G352900 | PF00560 | LRR_1 | 113 | 120 | 3.6e-06 | 26.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94C77 | Arabidopsis thaliana | sp|Q94C77|RPKL_ARATH Receptor protein kinase-like protein At4g34220 | 49.600% | Swiss-Prot | Medium |
C0LGS3 | Arabidopsis thaliana | sp|C0LGS3|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250 | 36.500% | Swiss-Prot | Medium |