TkA04G350060 | RubberDandelionOmics

Gene overview

TkA04G350060

Reference: TK1151 Chr: Chr04 Coordinates: 88357466-88362150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1552 bp · TkA04G350060|TK1151|cDNA

AAAATATTATATTATATTTAAAATAATAACTAATAGACAATTTTGATTTTTTCGCTTGACTTCCGATACATCTATCCGGCCGTGAACGTCGGATGTGATATTGCCACCGGCGGCGTCGTTCACCTCTCTGGCTCTCTCGTTCTCCGATGTTGAAACCTGACGCGCCGCCGTTTACCTCCCCCGCTGCTTCCTCTCACCTCACCTGCTGATGAAATCGCCACAGTCACCATCATTACCACCACCGCGCTCTGTCTCGGTAG...

CDS

Download CDS FASTA

1155 bp · TkA04G350060|TK1151|CDS

ATGAAATCGCCACAGTCACCATCATTACCACCACCGCGCTCTGTCTCGGTAGTCACTGAACACTCGTCATCCTCCTCCAGTTCTCCGTCTACTTCATCTGCTACTTCTTCGGATATGTGGAATTACATATGGATCCCTTTTCTGATAACTCTTTTGAGAGAAGTCAGCTCCGCTAAAGCTGCTTCTGAGTCAACAATCTTCTTGCCCTCTGACGCTGTTGCTGGATTGACTTCCTCGTGTCCTGCTCCGGATCCCCGGCT...

Protein

Download Protein FASTA

384 aa · TkA04G350060|TK1151|PROTEIN

MKSPQSPSLPPPRSVSVVTEHSSSSSSSPSTSSATSSDMWNYIWIPFLITLLREVSSAKAASESTIFLPSDAVAGLTSSCPAPDPRLNYRPIIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPPEVLQKKLNLINGVIFTGGWAKSGLYLDVVDGIFKQVLKKNDAGDHFPLLAICLGFELLTMIVSKNNDILEGFSASDQASTLQFIKNINIEGTLFQRFPPELLAKMSTECLVMQNHKFGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G350060`
TK1151 ID	TkA04G350060
OH-1004 ID	LXL04_037778
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G350060

Location Chr04:88357466-88362150 (-)

Description Similar to GGH2: Gamma-glutamyl hydrolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78680`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	A central role for gamma-glutamyl hydrolases in plant folate homeostasis.2010 · DOI: 10.1111/j.1365-313x.2010.04330.x
`At1g78660`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	No verified direct reference in this release
`At1g78670`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046900 tetrahydrofolylpolyglutamate metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0008242 omega peptidase activity Molecular Function

GO:0034722 gamma-glutamyl-peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78660

ath:AT1G78670

ath:AT1G78680

ddi:DDB_G0286535

gmx:547881

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.430

Rank 1 · TkA04G350060 · TK1151

Cell membrane0.168

Rank 2 · TkA04G350060 · TK1151

Cytoplasm0.135

Rank 3 · TkA04G350060 · TK1151

Extracellular0.134

Rank 4 · TkA04G350060 · TK1151

Endoplasmic reticulum0.122

Rank 5 · TkA04G350060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07722Peptidase_C2691-307 aa

PF00117GATase123-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G350060	`PF07722`	Peptidase_C26	91	307	4.6e-16	60.0
TkA04G350060	`PF00117`	GATase	123	318	3.4e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65355`	Arabidopsis thaliana	sp\|O65355\|GGH2_ARATH Gamma-glutamyl hydrolase 2	66.900%	Swiss-Prot	High
`Q9SYL6`	Arabidopsis thaliana	sp\|Q9SYL6\|GGH1_ARATH Gamma-glutamyl hydrolase 1	66.500%	Swiss-Prot	High
`Q9ZV85`	Arabidopsis thaliana	sp\|Q9ZV85\|GGH3_ARATH Probable gamma-glutamyl hydrolase 3	61.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card