LXL04_037778 | RubberDandelionOmics

Gene overview

LXL04_037778

Reference: OH-1004 Chr: Chr09 Coordinates: 20925161-20929705 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1315 bp · LXL04_037778|LXL04_037778|OH1004|cDNA

TTTTCGCTTGACTTCCGATACATCTATCCGGCCGTGAACGTCGGATGTGATATTGCCACCGGCGGCGTCGTTCACCTCTCTGGCTCTCTCGTTCTCCGATGTTGAAACCTGACGCGCCGCCGTTTACCTCCCCCGCTGCTTCCTCTCACCTCACCTGCTGATGAAATCGCCACAGTCACCATCATTACCACCACCGCGCTCTGTCTCGGTAGTCACTGAACACTCGTCATCCTCCTCCAGTTCTCCGTCTACTTCATCTG...

CDS

Download CDS FASTA

1161 bp · LXL04_037778|LXL04_037778|OH1004|CDS

CTGCTGATGAAATCGCCACAGTCACCATCATTACCACCACCGCGCTCTGTCTCGGTAGTCACTGAACACTCGTCATCCTCCTCCAGTTCTCCGTCTACTTCATCTGCTACTTCTTCGGATATGTGGAATTACATATGGATCCCTTTTCTGATAACTCTTTTGAGAGAAGTCAGCTCCGCTAAAGCTGCTTCTGAGTCAACAATCTTCTTGCCCTCTGACGCTGTTGCTGGATTGACTTCCTCGTGTCCTGCTCCGGATCC...

Protein

Download Protein FASTA

386 aa · LXL04_037778|LXL04_037778|OH1004|PROTEIN

MLMKSPQSPSLPPPRSVSVVTEHSSSSSSSPSTSSATSSDMWNYIWIPFLITLLREVSSAKAASESTIFLPSDAVAGLTSSCPAPDPRLNYRPIIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPPEVLQKKLNLINGVIFTGGWAKSGLYLDVVDGIFKQVLKKNDAGDHFPLLAICLGFELLTMIVSKNNDILEGFSASDQASTLQFIKNINIEGTLFQRFPPELLAKMSTECLVMQNHKFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037778`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037778

Location Chr09:20925161-20929705 (-)

Description Similar to GGH2: Gamma-glutamyl hydrolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78680`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	A central role for gamma-glutamyl hydrolases in plant folate homeostasis.2010 · DOI: 10.1111/j.1365-313x.2010.04330.x
`At1g78660`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	No verified direct reference in this release
`At1g78670`	Cleaves the polyglutamate sidechains of folate polyglutamates in the vacuole.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037778 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046900 tetrahydrofolylpolyglutamate metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0008242 omega peptidase activity Molecular Function

GO:0034722 gamma-glutamyl-peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78660

ath:AT1G78670

ath:AT1G78680

ddi:DDB_G0286535

gmx:547881

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.427

Rank 1 · LXL04_037778 · OH-1004

Cell membrane0.172

Rank 2 · LXL04_037778 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_037778 · OH-1004

Extracellular0.133

Rank 4 · LXL04_037778 · OH-1004

Endoplasmic reticulum0.122

Rank 5 · LXL04_037778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07722.20Peptidase_C2693-309 aa

PF00117.35GATase125-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037778	`PF07722.20`	Peptidase_C26	93	309	4.7e-16	59.9
LXL04_037778	`PF00117.35`	GATase	125	320	3.5e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65355`	Arabidopsis thaliana	Gamma-glutamyl hydrolase 2	66.763%	Swiss-Prot	strong database homology
`Q9SYL6`	Arabidopsis thaliana	Gamma-glutamyl hydrolase 1	66.565%	Swiss-Prot	strong database homology
`Q9ZV85`	Arabidopsis thaliana	Probable gamma-glutamyl hydrolase 3	63.050%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card