TkA04G345150 | RubberDandelionOmics

Gene overview

TkA04G345150

Reference: TK1151 Chr: Chr04 Coordinates: 87265664-87270225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3429 bp · TkA04G345150|TK1151|cDNA

GGATCGTTCAAATTACTCTTTCTATTGAACGCTCTCAATAGTTAGGCTCACATGCTCCCTGCAGCCGTTCGTAGTGCTCATGTCAGCAATAAGAATTTATTACGTTTAATTGGGAACTGGAAGGAAGCTACAGAAATCAAAAGACATCGCGTCTTCACTCCATCGCGACTTCGGGACCTCATTCCTCCGTCGCCGCAAGTCTGAATCGGGAGAGCTTGAAACTCCATCGCCGCCGACCAGCGCCCCACCTGTCTCCGGCC...

CDS

Download CDS FASTA

411 bp · TkA04G345150|TK1151|CDS

ATGCGCAAGGGCTTCTACCATGAAACTCAAATACTATCATGGGTTTTGAGTTATGACGGTTTACACCCCCAAGATTCTTTAGCTGTTACAGCAGCTGGAATTGCAGTAGCTTTGTCAGAAGTGCCAAATACAAACACCATATCAGGAGTCCGAATTGGATTAATTGATGATAAATTTGTTGTGAATTCAACAACCGCAAAGATGGAAAAATCAAAATTTGATTTATTATTAGCAGGCTCAGAAACCGGGATTTTGATGAT...

Protein

Download Protein FASTA

136 aa · TkA04G345150|TK1151|PROTEIN

MRKGFYHETQILSWVLSYDGLHPQDSLAVTAAGIAVALSEVPNTNTISGVRIGLIDDKFVVNSTTAKMEKSKFDLLLAGSETGILMIEGYCDFLHEEKLLQAIEIGHDAVKSHMQRAGQFGRAPCLGDKIICSNCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G345150`
TK1151 ID	TkA04G345150
OH-1004 ID	LXL04_012915
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 82.353 / OH-1004 12.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G345150

Location Chr04:87265664-87270225 (-)

Description Similar to PNP1: Probable polyribonucleotide nucleotidyltransferase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03710`	Involved in the metabolism of all major classes of plastid RNAs.	Unexpected Diversity of Chloroplast Noncoding RNAs as Revealed by Deep Sequencing of the Arabidopsis Transcriptome.2011 · DOI: 10.1534/g3.111.000752

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0168000`	Involved in the metabolism of all major classes of plastid RNAs.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012915 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000958 mitochondrial mRNA catabolic process Biological Process

GO:0000965 mitochondrial RNA 3'-end processing Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0006402 mRNA catabolic process Biological Process

GO:0008033 tRNA processing Biological Process

GO:0010323 negative regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0016120 carotene biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT3G03710

cab:CAB730

cca:CCA_00762

dosa:Os07g0168000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.406

Rank 1 · TkA04G345150 · TK1151

Mitochondrion0.265

Rank 2 · TkA04G345150 · TK1151

Nucleus0.163

Rank 3 · TkA04G345150 · TK1151

Peroxisome0.154

Rank 4 · TkA04G345150 · TK1151

Extracellular0.039

Rank 5 · TkA04G345150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03725RNase_PH_C46-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G345150	`PF03725`	RNase_PH_C	46	109	2.7e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZQ3`	Arabidopsis thaliana	sp\|Q8GZQ3\|PNP1_ARATH Polyribonucleotide nucleotidyltransferase 1, chloroplastic	67.000%	Swiss-Prot	High
`Q69LE7`	Oryza sativa subsp. japonica	sp\|Q69LE7\|PNP1_ORYSJ Probable polyribonucleotide nucleotidyltransferase 1, chloroplastic	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card