TkA04G339820 | RubberDandelionOmics

Gene overview

TkA04G339820

Reference: TK1151 Chr: Chr04 Coordinates: 85832320-85844728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1742 bp · TkA04G339820|TK1151|cDNA

TGTTTGCCATCTGTTTTTTACGATCTCATCTGCCCTTCAATTTCCATTTTCTTTTTGCCTTCTTAATCTTCTTCTTCAGCTTTTCTCTACATACTCTTCCTCTTTACCAAACTTTACTCTCCTTTATGCTTGGATTCGTCGTCGACTGGGGTTACAGTTTCCGAAATCTGTGACTTGAAGGTTTCATTCATCAAGATCTGTGAATTGAAGGGCGATTTCAAGCTTATTGAAGTGAAGATTGTCGGTTTCTTCACCAATTG...

CDS

Download CDS FASTA

1152 bp · TkA04G339820|TK1151|CDS

ATGTCAGATTATCTATGCGAAGAGTTGATTGATGAAATATTTACAAGACTACCTTCCAAATCCCTCCTGCGATTTAGATCACTCTCAAAATCCTTATGGAGTTCTATTTCTAGCCCCGGTTTCATACGCATGCACACTTTTCGATCCCCACAAAAAATCTGTTTCAGGCATGTCATGAATGACGAAGAAAGATCCTCATCTTTTTATACATTACATGGAGAAGACGAATTGCCATATTGTTTGTGTCCGCAACGCGGATA...

Protein

Download Protein FASTA

384 aa · TkA04G339820|TK1151|PROTEIN

MSDYLCEELIDEIFTRLPSKSLLRFRSLSKSLWSSISSPGFIRMHTFRSPQKICFRHVMNDEERSSSFYTLHGEDELPYCLCPQRGYIGFSLWNPSIRRKLNVPQCPQRSDPLLEGIGFGFDPLNDDYKIVWFSCAEGKENSYVYAMKTGAWCEIASPKPQFTRFSWVDSFSFNGVLHWKVGQSLSKPQDGSFFYIMTFDLSTHVFGMIPLPRPNYDWMTTNITTFKDSLALVSHGMKLNDTWIWIWRDDSWSVGFKLGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G339820`
TK1151 ID	TkA04G339820
OH-1004 ID	LXL04_037729
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.800
Protein coverage (%)	TK1151 79.688 / OH-1004 81.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G339820

Location Chr04:85832320-85844728 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release
`At2g43440`	F-box protein At2g43440.	No verified direct reference in this release
`At3g52320`	Putative F-box protein At3g52320.	No verified direct reference in this release
`At5g18160`	F-box protein At5g18160.	No verified direct reference in this release
`At4g21240`	Putative F-box protein At4g21240.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G16210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA04G339820 · TK1151

Nucleus0.375

Rank 2 · TkA04G339820 · TK1151

Cell membrane0.184

Rank 3 · TkA04G339820 · TK1151

Endoplasmic reticulum0.095

Rank 4 · TkA04G339820 · TK1151

Lysosome / Vacuole0.046

Rank 5 · TkA04G339820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-39 aa

PF07734FBA_181-247 aa

PF08268FBA_390-250 aa

PF11178DUF2963189-203 aa

PF07734FBA_1279-303 aa

PF11178DUF2963286-313 aa

PF00646F-box359-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G339820	`PF00646`	F-box	5	39	0.00013	22.4
TkA04G339820	`PF07734`	FBA_1	81	247	6e-13	49.2
TkA04G339820	`PF08268`	FBA_3	90	250	8.5e-15	55.3
TkA04G339820	`PF11178`	DUF2963	189	203	0.066	13.3
TkA04G339820	`PF07734`	FBA_1	279	303	6e-13	49.2
TkA04G339820	`PF11178`	DUF2963	286	313	0.066	13.3
TkA04G339820	`PF00646`	F-box	359	375	0.00013	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	29.000%	Swiss-Prot	Low
`A8MS20`	Arabidopsis thaliana	sp\|A8MS20\|FB350_ARATH F-box protein At2g43440	27.300%	Swiss-Prot	Low
`Q9FT50`	Arabidopsis thaliana	sp\|Q9FT50\|FB202_ARATH Putative F-box protein At3g52320	24.300%	Swiss-Prot	Low
`Q9FK54`	Arabidopsis thaliana	sp\|Q9FK54\|FB260_ARATH F-box protein At5g18160	24.700%	Swiss-Prot	Low
`O49565`	Arabidopsis thaliana	sp\|O49565\|FB239_ARATH Putative F-box protein At4g21240	29.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card