TkA04G285190 | RubberDandelionOmics

Gene overview

TkA04G285190

Reference: TK1151 Chr: Chr04 Coordinates: 71791663-71793351 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA04G285190|TK1151|cDNA

ATGTCATCTTTCTCCGAGAAAAGAACCGCAAAGGTGGAACATTTCTCCGGTAGTAAAGATAAAGAAAATCTGAATCCTGTTGATGACAGAAGCAAAATGGTCAAAGGGTTAGAAACAGTGGAAGAGAATTTAGATGCAGATTTATTATTTTCTCCTGATAGAATTTTAAGCAAGTTAAATACACCAAAGGGCCCACATACTGTTTCTGGAAAGAGGAACAAGGGTGGGACCGGGAGTCGGTTTGGTGCATGTGTACAATT...

CDS

Download CDS FASTA

501 bp · TkA04G285190|TK1151|CDS

ATGTCATCTTTCTCCGAGAAAAGAACCGCAAAGGTGGAACATTTCTCCGGTAGTAAAGATAAAGAAAATCTGAATCCTGTTGATGACAGAAGCAAAATGGTCAAAGGGTTAGAAACAGTGGAAGAGAATTTAGATGCAGATTTATTATTTTCTCCTGATAGAATTTTAAGCAAGTTAAATACACCAAAGGGCCCACATACTGTTTCTGGAAAGAGGAACAAGGGTGGGACCGGGAGTCGGTTTGGTGCATGTGTACAATT...

Protein

Download Protein FASTA

166 aa · TkA04G285190|TK1151|PROTEIN

MSSFSEKRTAKVEHFSGSKDKENLNPVDDRSKMVKGLETVEENLDADLLFSPDRILSKLNTPKGPHTVSGKRNKGGTGSRFGACVQLHSCPSSVPIHDAVVENSGIFGETPMKKSLESPSAWKSPWFSFVPGPRVDTDITIEANCSYMTLKVLNEMISEKAEDVFE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G285190`
TK1151 ID	TkA04G285190
OH-1004 ID	LXL04_023519
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.100
Protein coverage (%)	TK1151 66.265 / OH-1004 15.451 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G285190

Location Chr04:71791663-71793351 (-)

Description Similar to MYB3R1: Transcription factor MYB3R-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11510`	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters.	R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.02801 Laser microdissection of Arabidopsis cells at the powdery mildew infection site reveals site-specific processes and regulators.2010 · DOI: 10.1073/pnas.0912492107 Mutations in MYB3R1 and MYB3R4 cause pleiotropic developmental defects and preferential down-regulation of multiple G2/M-specific genes in Arabidopsis.2011 · DOI: 10.1104/pp.111.180836 Genetic interaction between G2/M phase-specific transcription factor MYB3R4 and MAPKKK ANP3 for execution of cytokinesis in Arabidopsis thaliana.2015 · DOI: 10.4161/15592324.2014.990817

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023519 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1901181 negative regulation of cellular response to caffeine Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G32730

ath:AT5G11510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · TkA04G285190 · TK1151

Cytoplasm0.274

Rank 2 · TkA04G285190 · TK1151

Cell membrane0.033

Rank 3 · TkA04G285190 · TK1151

Mitochondrion0.030

Rank 4 · TkA04G285190 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA04G285190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94FL9`	Arabidopsis thaliana	sp\|Q94FL9\|MB3R4_ARATH Transcription factor MYB3R-4	60.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card