Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1731 bp · LXL04_023519|LXL04_023519|OH1004|cDNA
ATGGGAGAGGGAAGGGTGAGAAACAGAATGAGTTCTTCAAAGAACAGGCCCATTGACCCTGTCAGGAAATACGGGGCACAAGATCCACATAACAAATCAAACTTTACCTGCACTTTCTTTGGAACAGTGGTGAAGGAAGGTGCATATCGCCACAAACAACATTTGATCGGTGGTTTTAAGGACACAAAAAACAGTCCAgaacatCTGCATGAACATGATGAATACGATGATGTTGATGATGAAGAAGTTGAAATAGCCCC...
1731 bp · LXL04_023519|LXL04_023519|OH1004|CDS
ATGGGAGAGGGAAGGGTGAGAAACAGAATGAGTTCTTCAAAGAACAGGCCCATTGACCCTGTCAGGAAATACGGGGCACAAGATCCACATAACAAATCAAACTTTACCTGCACTTTCTTTGGAACAGTGGTGAAGGAAGGTGCATATCGCCACAAACAACATTTGATCGGTGGTTTTAAGGACACAAAAAACAGTCCAGAACATCTGCATGAACATGATGAATACGATGATGTTGATGATGAAGAAGTTGAAATAGCCCC...
Protein
Download Protein FASTA576 aa · LXL04_023519|LXL04_023519|OH1004|PROTEIN
MGEGRVRNRMSSSKNRPIDPVRKYGAQDPHNKSNFTCTFFGTVVKEGAYRHKQHLIGGFKDTKNSPEHLHEHDEYDDVDDEEVEIAPPKKSRQKGPMDMHYTPNPYETIKDRNRKAGKQQTINEVFLTYESFKVVVEAIRQLGPGMKPPSMYELRVPILKKEVENVKAEKGCSIYLMDGAIQWCKRTSSTFPMMIHNPNSVLREELDLQNPDSVLRGELELELELGFLQCIDVDHDLEPMENNIVGLDMEDGCRHPGGST...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023519 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023519 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:47379813-47383538 (+) | |||||||||
| Description | Similar to MYB3R1: Transcription factor MYB3R-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0009620 response to fungus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0032465 regulation of cytokinesis Biological Process GO:0032875 regulation of DNA endoreduplication Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0050832 defense response to fungus Biological Process GO:1901181 negative regulation of cellular response to caffeine Biological Process GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G32730 ath:AT5G11510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.