TkA04G261740 | RubberDandelionOmics

Gene overview

TkA04G261740

Reference: TK1151 Chr: Chr04 Coordinates: 66165073-66175095 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5017 bp · TkA04G261740|TK1151|cDNA

AAGGTGAGTTGTCAAATGCAAATAGACACATGCTATCTCTCTTTTTTCCCTCTTTCTTGAATGTCCAGCACCATCGACTTAAATCCAGGAACCAAATCGGTCAAAGCAAACCCCTTTTAAGCCACCCATGACCCATCAAATCCTTTTCTAAAATTTCAACCAAATCCGACAATTTTTAATCTTAACTCGTTTGTCACAAACCATTGGGTTTTCTTTTTCTTTACAATTTCAAGAAAACCCCCTTGTAAAAAAGTCTACAG...

CDS

Download CDS FASTA

3675 bp · TkA04G261740|TK1151|CDS

ATGAATTCGATGGTGAAGTATTTCTTCTTGGTGTTTCAAGTTTGCGTCATTGCAAGTACTCTGGTTCTTCAAGGATCTTCAGGGCAAACAATATCACCATCGTCTAGTTTTTCTGGTGTTCCTCCCATTATTGAAGGCCAAATAACCAGGAATTCACCTGGCCCAACATCTCAACAAAACGGTCCTCCACATCTCCAACCTCCAAATGAACCACCACCAAATGCCGGAGCCGCGGGGCCAATTACATCGATCCCGGAAGG...

Protein

Download Protein FASTA

1224 aa · TkA04G261740|TK1151|PROTEIN

MNSMVKYFFLVFQVCVIASTLVLQGSSGQTISPSSSFSGVPPIIEGQITRNSPGPTSQQNGPPHLQPPNEPPPNAGAAGPITSIPEGSPPSPPAVAPTIPVSVPPIPQPEKGPEPKSPANPPTMPIVPVEIAPPPKDVIQNPPPVAQVPPPVPETPPLILPGPVASPPNKLPVASPPTNPTLPIPPPSNLPLPALIPPSALPSSPPTFPPPGPVAPPPNKLPVASSPTNPTLPIPPPSNLPLPAVIPPSALQSSPPTFPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G261740`
TK1151 ID	TkA04G261740
OH-1004 ID	LXL04_008298
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.500
Protein coverage (%)	TK1151 51.797 / OH-1004 75.919 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G261740

Location Chr04:66165073-66175095 (+)

Description Similar to ALE2: Receptor-like serine/threonine-protein kinase ALE2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20300`	Required during the differentiation of the protoderm into shoots epidermis and cuticle.	Novel receptor-like kinase ALE2 controls shoot development by specifying epidermis in Arabidopsis.2007 · DOI: 10.1242/dev.003533
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g13160`	Protein kinase required for plant defense mechanism mediated by the disease resistance (R) protein RPS5.	The Arabidopsis PBS1 resistance gene encodes a member of a novel protein kinase subfamily.2001 · DOI: 10.1046/j.1365-313x.2001.01014.x Cleavage of Arabidopsis PBS1 by a bacterial type III effector.2003 · DOI: 10.1126/science.1085671 Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease.2007 · DOI: 10.1073/pnas.0608779104 Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 Activation of a plant nucleotide binding-leucine rich repeat disease resistance protein by a modified self protein.2012 · DOI: 10.1111/j.1462-5822.2012.01779.x
`At1g76370`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0372100`	Functions as an immediate downstream signaling partner of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008298 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0010068 protoderm histogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090558 plant epidermis development Biological Process

GO:1905393 plant organ formation Biological Process

KEGG gene cross-reference

ath:AT1G68690

ath:AT2G20300

ath:AT5G13160

ath:AT5G38560

dosa:Os05g0372100

osa:4338592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · TkA04G261740 · TK1151

Cytoplasm0.090

Rank 2 · TkA04G261740 · TK1151

Nucleus0.083

Rank 3 · TkA04G261740 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA04G261740 · TK1151

Extracellular0.021

Rank 5 · TkA04G261740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23180ALE2_N590-708 aa

PF17870Insulin_TMD749-776 aa

PF03707MHYT754-783 aa

PF00069Pkinase843-1049 aa

PF07714PK_Tyr_Ser-Thr847-1115 aa

PF03109ABC1848-877 aa

PF01636APH914-991 aa

PF03109ABC1956-1002 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G261740	`PF23180`	ALE2_N	590	708	1.1e-53	181.1
TkA04G261740	`PF17870`	Insulin_TMD	749	776	1.1	10.1
TkA04G261740	`PF03707`	MHYT	754	783	0.29	11.9
TkA04G261740	`PF00069`	Pkinase	843	1049	5.9e-43	147.9
TkA04G261740	`PF07714`	PK_Tyr_Ser-Thr	847	1115	1.1e-47	163.2
TkA04G261740	`PF03109`	ABC1	848	877	0.0023	17.9
TkA04G261740	`PF01636`	APH	914	991	0.021	15.3
TkA04G261740	`PF03109`	ABC1	956	1002	0.0023	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWW0`	Arabidopsis thaliana	sp\|Q8RWW0\|ALE2_ARATH Receptor-like serine/threonine-protein kinase ALE2	52.700%	Swiss-Prot	High
`Q9LDZ5`	Arabidopsis thaliana	sp\|Q9LDZ5\|PBL21_ARATH Probable serine/threonine-protein kinase PBL21	52.700%	Swiss-Prot	Low
`Q9FE20`	Arabidopsis thaliana	sp\|Q9FE20\|PBS1_ARATH Serine/threonine-protein kinase PBS1	53.600%	Swiss-Prot	Low
`Q9SFX0`	Arabidopsis thaliana	sp\|Q9SFX0\|PBL22_ARATH Probable serine/threonine-protein kinase PBL22	50.200%	Swiss-Prot	Low
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	56.400%	Swiss-Prot	Low
`Q6I5Q6`	Oryza sativa subsp. japonica	sp\|Q6I5Q6\|RK185_ORYSJ Receptor-like cytoplasmic kinase 185	54.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card