TkA04G234390 | RubberDandelionOmics

Gene overview

TkA04G234390

Reference: TK1151 Chr: Chr04 Coordinates: 59507745-59510450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1138 bp · TkA04G234390|TK1151|cDNA

AAAAGGATTGCTGCTCAAGTTTTATTATTTGGCCCTTCAACTTTTGGAAATAAAAGTTGAGTCCTCTATGTCTACTTCTTTTGGGTCTTTCTTTCCTTCCAAGCCAACCAGGAACCCTTATACCCCTTCATAATCTTCCACCTCTGCAACAAATCGCGACTCATTTGAAACTTCATAGACATTCTTCACATCTCGCATCTTAAATTCCTCCACAGGATCCTTCACTGATATTCTATACGCCATGGGTGATAGTCAGTACT...

CDS

Download CDS FASTA

708 bp · TkA04G234390|TK1151|CDS

ATGGGTGATAGTCAGTACTCGTTTTCTCTTACAACTTTCAGCCCTTCAGGAAAGCTTGTTCAGATTGAGCATGCCCTAACAGCTGTTGGTTCTGGGCAAACTTCATTGGGAATTAAAGCTTCAAATGGGGTTGTAATTGCAACTGAAAAGAAGCTCCCATCAATCTTAGTCGATGAGACCTCTGTGCAAAAGATTCAGATTTTGACTCCTAATATTGGAGTTGTATATAGTGGCATGGGGCCCGATTCTAGGGTTTTAGT...

Protein

Download Protein FASTA

235 aa · TkA04G234390|TK1151|PROTEIN

MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDETSVQKIQILTPNIGVVYSGMGPDSRVLVRKSRKQAEQYHRLYKEPIPVTQLVRETAAVMQEFTQSGGVRPFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTDDMELEDAIHTAILTLKEGFEGQISGKNIEIGVIEADKTFRVLTAAQIEDYLQEVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G234390`
TK1151 ID	TkA04G234390
OH-1004 ID	LXL04_039328
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G234390

Location Chr04:59507745-59510450 (+)

Description Similar to PAB1: Proteasome subunit alpha type-2-A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16470`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`At1g79210`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YVR7`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`Os03g0387100`	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039328 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005839 proteasome core complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019773 proteasome core complex, alpha-subunit complex Cellular Component

KEGG gene cross-reference

ath:AT1G16470

ath:AT1G79210

ddi:DDB_G0292122

dosa:Os03g0387100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.714

Rank 1 · TkA04G234390 · TK1151

Nucleus0.629

Rank 2 · TkA04G234390 · TK1151

Mitochondrion0.045

Rank 3 · TkA04G234390 · TK1151

Cell membrane0.032

Rank 4 · TkA04G234390 · TK1151

Peroxisome0.030

Rank 5 · TkA04G234390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00227Proteasome3-34 aa

PF10584Proteasome_A_N6-28 aa

PF00227Proteasome31-213 aa

PF10584Proteasome_A_N146-150 aa

PF21096RecA_C148-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G234390	`PF00227`	Proteasome	3	34	1.7e-59	201.4
TkA04G234390	`PF10584`	Proteasome_A_N	6	28	6.6e-09	36.0
TkA04G234390	`PF00227`	Proteasome	31	213	1.7e-59	201.4
TkA04G234390	`PF10584`	Proteasome_A_N	146	150	6.6e-09	36.0
TkA04G234390	`PF21096`	RecA_C	148	191	0.014	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23708`	Arabidopsis thaliana	sp\|O23708\|PSA2A_ARATH Proteasome subunit alpha type-2-A	93.200%	Swiss-Prot	High
`Q8L4A7`	Arabidopsis thaliana	sp\|Q8L4A7\|PSA2B_ARATH Proteasome subunit alpha type-2-B	92.300%	Swiss-Prot	High
`A2YVR7`	Oryza sativa subsp. indica	sp\|A2YVR7\|PSA2_ORYSI Proteasome subunit alpha type-2	89.400%	Swiss-Prot	High
`Q10KF0`	Oryza sativa subsp. japonica	sp\|Q10KF0\|PSA2_ORYSJ Proteasome subunit alpha type-2	89.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card