TkA04G228690 | RubberDandelionOmics

Gene overview

TkA04G228690

Reference: TK1151 Chr: Chr04 Coordinates: 58146705-58151277 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2636 bp · TkA04G228690|TK1151|cDNA

ATTACTTGTGCCAACTACCAAACAATATCTTCTTACTATTGCAATTTCGTTATACATGTAAAGCTGATGTGGCATTGAAGCAAACCGTATGTTTCGTTGAGGTTTGTGGATAATTCCATTTCAAAAAACAAGGAACCAAACGCTAACAACCGCAAATCTTCAGCAGAATGAGAGACTTGAATGCTCTCTCCGGTGGCTACAACGTAACGCCAGTCACATTTAACCCTACCGGCTTCAACAACACTCGCATTTGCTTCAAC...

CDS

Download CDS FASTA

2229 bp · TkA04G228690|TK1151|CDS

ATGAGAGACTTGAATGCTCTCTCCGGTGGCTACAACGTAACGCCAGTCACATTTAACCCTACCGGCTTCAACAACACTCGCATTTGCTTCAACAGTTTCGCTATTCGGAGGTGTATTCCTTTTGAATTGCGGAAATCTACTTGGACGCCGAAGTTTTTCGAGATGAAACGAAGGAACAAATCGATACCTCGTTCGTCGTCCTCAACAACGTCTCCGGCAGATCCACCAGTTACTCCTCCACCTCCTCCAGAGCAACCAGC...

Protein

Download Protein FASTA

742 aa · TkA04G228690|TK1151|PROTEIN

MRDLNALSGGYNVTPVTFNPTGFNNTRICFNSFAIRRCIPFELRKSTWTPKFFEMKRRNKSIPRSSSSTTSPADPPVTPPPPPEQPAKTDENAPRKGPDLPTLYRRFYKVAAPYWYSDDKVQARIQLASVFALTLGTTGISVGFNFLGRDFYNALANKDQAQFTTQLTYYLAAFAGGIPIFVLRDYARETLALRWRSWMTNYYMERYLKNQTFYQIQSQSIIDNPDQRIVDDLSSFTGTSLSFSLTLFNAIIDLISFSNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G228690`
TK1151 ID	TkA04G228690
OH-1004 ID	LXL04_039363
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G228690

Location Chr04:58146705-58151277 (+)

Description Similar to ABCC2: ABC transporter D family member 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54350`	ABC transporter D family member 2, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G54350

hin:HI_0036

hin:HI_1467

mtu:Rv1819c

mtv:RVBD_1819c

syn:sll0182

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.931

Rank 1 · TkA04G228690 · TK1151

Mitochondrion0.083

Rank 2 · TkA04G228690 · TK1151

Cytoplasm0.020

Rank 3 · TkA04G228690 · TK1151

Peroxisome0.016

Rank 4 · TkA04G228690 · TK1151

Nucleus0.014

Rank 5 · TkA04G228690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06472ABC_membrane_2120-376 aa

PF00664ABC_membrane131-396 aa

PF05992SbmA_BacA159-426 aa

PF13521AAA_28165-200 aa

PF17239DUF5312322-346 aa

PF17239DUF5312391-455 aa

PF00437T2SSE462-519 aa

PF12775AAA_7466-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G228690	`PF06472`	ABC_membrane_2	120	376	4.3e-51	174.6
TkA04G228690	`PF00664`	ABC_membrane	131	396	0.00023	21.7
TkA04G228690	`PF05992`	SbmA_BacA	159	426	1.8e-19	71.0
TkA04G228690	`PF13521`	AAA_28	165	200	0.45	11.4
TkA04G228690	`PF17239`	DUF5312	322	346	0.079	12.1
TkA04G228690	`PF17239`	DUF5312	391	455	0.079	12.1
TkA04G228690	`PF00437`	T2SSE	462	519	0.0055	16.1
TkA04G228690	`PF12775`	AAA_7	466	508	0.072	13.3
TkA04G228690	`PF20030`	bpMoxR	472	510	0.093	12.5
TkA04G228690	`PF03193`	RsgA_GTPase	472	511	0.14	12.7
TkA04G228690	`PF20703`	nSTAND1	477	522	0.00047	20.6
TkA04G228690	`PF25201`	nSTAND6	477	509	0.24	12.1
TkA04G228690	`PF00005`	ABC_tran	479	685	5.2e-19	69.9
TkA04G228690	`PF13476`	AAA_23	479	509	0.0051	18.2
TkA04G228690	`PF01580`	FtsK_SpoIIIE	480	508	0.047	13.8
TkA04G228690	`PF01078`	Mg_chelatase	480	511	0.26	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLC1`	Arabidopsis thaliana	sp\|Q6NLC1\|AB2D_ARATH ABC transporter D family member 2, chloroplastic	66.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card