LXL04_039363 | RubberDandelionOmics

Gene overview

LXL04_039363

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 4394016-4398124 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2337 bp · LXL04_039363|LXL04_039363|OH1004|cDNA

ATGAGAGACTTGAATGCTCTCTCCGGTGGCTACAACGTAACGCCAGTCACATTTAACCCTACCGGCTTCAACAACACTCGCATTTGCTTCAACAGTTTCGCTATTCGGAGGTGTATTCCTTTTGAATTGCGGAAATCTACTTGGACGCCGAAGTTTTTCGAGATGAAACGAAGGAACAAATCGATACCTCGTTCGTCGTCCTCAACAACGTCTCCGGCAGATCCACCAGTTACTCCTCCACCTCCTCCAGAGCAACCAGC...

CDS

Download CDS FASTA

2337 bp · LXL04_039363|LXL04_039363|OH1004|CDS

ATGAGAGACTTGAATGCTCTCTCCGGTGGCTACAACGTAACGCCAGTCACATTTAACCCTACCGGCTTCAACAACACTCGCATTTGCTTCAACAGTTTCGCTATTCGGAGGTGTATTCCTTTTGAATTGCGGAAATCTACTTGGACGCCGAAGTTTTTCGAGATGAAACGAAGGAACAAATCGATACCTCGTTCGTCGTCCTCAACAACGTCTCCGGCAGATCCACCAGTTACTCCTCCACCTCCTCCAGAGCAACCAGC...

Protein

Download Protein FASTA

778 aa · LXL04_039363|LXL04_039363|OH1004|PROTEIN

MRDLNALSGGYNVTPVTFNPTGFNNTRICFNSFAIRRCIPFELRKSTWTPKFFEMKRRNKSIPRSSSSTTSPADPPVTPPPPPEQPAKTDEVTVYCDFQLFKSVDIVYSSFISDSNLTLKLSRFFYQNAPRKGPDLPTLYRRFYKVAAPYWYSDDKVQARIQLASVFALTLGTTGISVGFNFLGRDFYNALANKDQAQFTTQLTYYLAAFAGGIPIFVLRDYARETLALRWRSWMTNYYMERYLKNQTFYQIQSQSIIDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039363`
TK1151 ID	TkA04G228690
OH-1004 ID	LXL04_039363
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039363

Location JAJTUU010000010.1:4394016-4398124 (-)

Description Similar to ABCC2: ABC transporter D family member 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54350`	ABC transporter D family member 2, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039363 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G54350

hin:HI_0036

hin:HI_1467

mtu:Rv1819c

mtv:RVBD_1819c

syn:sll0182

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · LXL04_039363 · OH-1004

Mitochondrion0.072

Rank 2 · LXL04_039363 · OH-1004

Cytoplasm0.022

Rank 3 · LXL04_039363 · OH-1004

Peroxisome0.019

Rank 4 · LXL04_039363 · OH-1004

Nucleus0.015

Rank 5 · LXL04_039363 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06472.21ABC_membrane_2156-412 aa

PF05992.18SbmA_BacA195-462 aa

PF00005.34ABC_tran515-721 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039363	`PF06472.21`	ABC_membrane_2	156	412	4.7e-51	174.5
LXL04_039363	`PF05992.18`	SbmA_BacA	195	462	2.1e-19	70.8
LXL04_039363	`PF00005.34`	ABC_tran	515	721	1.6e-18	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLC1`	Arabidopsis thaliana	ABC transporter D family member 2, chloroplastic	67.727%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card