Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1780 bp · TkA04G228620|TK1151|cDNA
CTTATATCGAAGAGCTGTGGAGAAAACCCGAAACCACCCAAAGTGACCGATGCGCAATTCATAATTAACAGAGTTCATCGCATTCCTCGAAGGGGTAATGTTACAGATAACCATAGTGCAGGGGGTTGTCCAAATTTGACCTAAATTTGCAGTTCGCATATAAGAGCGTATCCTATTGCACAATTTAGGGTTCTGCAACTCACAACTCGCAGTAATTTTCCCCCAATATTGTTCCTATCGACCCGATTAAGATTAATGGG...
1266 bp · TkA04G228620|TK1151|CDS
ATGGGCGTGATTGACATATACAATGGTTCATCTGTTTGCATGGTCAAATCCAACAACGGTTTTTGCTTTTCACCATCACTGAATACAATCACTTGTGCTTTTTCAAGGAATCAGAGGAAGGTCAGTTGCATGGCCTCTATTAGCGCCGCGGTCAAAGAGGGACAACAACAACTGACTGGGGATTCCTTTATCAGACCTCATCTTAGGGAATTGTCTCCATACCAACCTATATTGCCCTTCGAGGTTTTGTCAACTCGTCT...
Protein
Download Protein FASTA421 aa · TkA04G228620|TK1151|PROTEIN
MGVIDIYNGSSVCMVKSNNGFCFSPSLNTITCAFSRNQRKVSCMASISAAVKEGQQQLTGDSFIRPHLRELSPYQPILPFEVLSTRLGRKPEEIVKLDANENPYGPPPEVFEALGAMKFPYIYPDPESRRLRAALAKDSGLESQYILVGCGADELIDLIMRCVLDPGDCIVDCPPTFTMYEFDAAVNCARVIKVPRKTDFSLDVEKITEAISHEKPKIIFLTSPNNPDGSVISDDVLLKILKQQILVVLDEAYIEFSGQE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G228620 |
|---|---|
| TK1151 ID | TkA04G228620 |
| OH-1004 ID | LXL04_007451 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 25.700 |
| Protein coverage (%) | TK1151 68.646 / OH-1004 63.768Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G228620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:58120776-58123815 (+) | |||||||||
| Description | Similar to Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006520 amino acid metabolic process Biological Process GO:0009094 L-phenylalanine biosynthetic process Biological Process GO:0009095 aromatic amino acid family biosynthetic process, prephenate pathway Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0004069 L-aspartate:2-oxoglutarate aminotransferase activity Molecular Function GO:0008483 transaminase activity Molecular Function GO:0030170 pyridoxal phosphate binding Molecular Function GO:0033853 aspartate-prephenate aminotransferase activity Molecular Function GO:0033854 glutamate-prephenate aminotransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G22250 cte:CT0966 rpr:RP091 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00155Aminotran_1_293-414 aaPF23493CysS_C127-137 aaPF04864Alliinase_C142-292 aaPF23493CysS_C370-388 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G228620 | PF00155 | Aminotran_1_2 | 93 | 414 | 1.9e-56 | 192.5 |
| TkA04G228620 | PF23493 | CysS_C | 127 | 137 | 0.06 | 14.2 |
| TkA04G228620 | PF04864 | Alliinase_C | 142 | 292 | 3.5e-06 | 26.9 |
| TkA04G228620 | PF23493 | CysS_C | 370 | 388 | 0.06 | 14.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.