TkA04G180420 | RubberDandelionOmics

Gene overview

TkA04G180420

Reference: TK1151 Chr: Chr04 Coordinates: 46716165-46718758 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1716 bp · TkA04G180420|TK1151|cDNA

ATGCATCTGTAGCCACATATGTACCTACCAGGATCGGATCTTCTTGTTATTCCATAAACACCCCTATCCCACTAAACATTTACATTCTGTACCATTCTTCCTTTCTCTTTATGTATTCAGATTCTGTTTGTGCATTCGAGTGCAAGCATATTCAAAAATCGAACCCTTGTTTCCACTTGAAAGCCGGATTTGTTTCTTAGGGCTTTCGGTTTGTAATGGTGGAACCAATGAGTGGCGTTGAAGATCACGGTGGCTCCGAG...

CDS

Download CDS FASTA

1221 bp · TkA04G180420|TK1151|CDS

ATGGTGGAACCAATGAGTGGCGTTGAAGATCACGGTGGCTCCGAGGAGGAATTTCTGTTAACGGAGGTAAATATAGGCGGCGGCGGTGGAAGTACCGGTGCTTGTGACGTGTCATGGCGGTTGAACTTCGACGGGTTTCAATTCTCGTCGGAACATAAAGAGAAACCGCCTCGAGGTTTCCATGACTGCCTTGGGGTTTTAGGTCCAGAAGACAATGTAGCAGAGTATTACCAACAGCAGGTAGAGATGCTGGAGGGCTT...

Protein

Download Protein FASTA

406 aa · TkA04G180420|TK1151|PROTEIN

MVEPMSGVEDHGGSEEEFLLTEVNIGGGGGSTGACDVSWRLNFDGFQFSSEHKEKPPRGFHDCLGVLGPEDNVAEYYQQQVEMLEGFTEMDALAERGFVPRLSEEEKACLARRETLAIRISNIANMILFIAKVYASIKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKRRMQPLGILVFASVMATLGLQIILESVRTLASNEKDFNLTKEQEEWVIGIMLSVTLVKLVLCIYCRSFTNEIVKAYAQDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G180420`
TK1151 ID	TkA04G180420
OH-1004 ID	LXL04_035015
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G180420

Location Chr04:46716165-46718758 (-)

Description Similar to MTP5: Metal tolerance protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39450`	Cation/proton antiporter involved in endogenous manganese tolerance probably through vesicular trafficking and exocytosis.	A secretory pathway-localized cation diffusion facilitator confers plant manganese tolerance.2007 · DOI: 10.1073/pnas.0609507104 A role for the AtMTP11 gene of Arabidopsis in manganese transport and tolerance.2007 · DOI: 10.1111/j.1365-313x.2007.03138.x
`At1g16310`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release
`At1g79520`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837800`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release
`Os05g0461900`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035015 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010042 response to manganese ion Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0046688 response to copper ion Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:2000031 regulation of salicylic acid mediated signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16310

ath:AT1G79520

ath:AT2G39450

dosa:Os01g0837800

dosa:Os05g0461900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.320

Rank 1 · TkA04G180420 · TK1151

Golgi apparatus0.300

Rank 2 · TkA04G180420 · TK1151

Lysosome / Vacuole0.261

Rank 3 · TkA04G180420 · TK1151

Endoplasmic reticulum0.216

Rank 4 · TkA04G180420 · TK1151

Cell membrane0.212

Rank 5 · TkA04G180420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01545Cation_efflux120-312 aa

PF02659Mntp145-165 aa

PF230216TM_2nd_PGAP2IP176-203 aa

PF02659Mntp190-233 aa

PF230216TM_2nd_PGAP2IP219-239 aa

PF230216TM_2nd_PGAP2IP258-306 aa

PF02659Mntp261-295 aa

PF16916ZT_dimer323-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G180420	`PF01545`	Cation_efflux	120	312	3e-30	106.2
TkA04G180420	`PF02659`	Mntp	145	165	5.1	7.6
TkA04G180420	`PF23021`	6TM_2nd_PGAP2IP	176	203	1.2	9.6
TkA04G180420	`PF02659`	Mntp	190	233	5.1	7.6
TkA04G180420	`PF23021`	6TM_2nd_PGAP2IP	219	239	1.2	9.6
TkA04G180420	`PF23021`	6TM_2nd_PGAP2IP	258	306	1.2	9.6
TkA04G180420	`PF02659`	Mntp	261	295	5.1	7.6
TkA04G180420	`PF16916`	ZT_dimer	323	392	9.8e-08	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80632`	Arabidopsis thaliana	sp\|O80632\|MTP11_ARATH Metal tolerance protein 11	80.500%	Swiss-Prot	High
`Q0WU02`	Arabidopsis thaliana	sp\|Q0WU02\|MTP10_ARATH Metal tolerance protein 10	60.700%	Swiss-Prot	High
`Q9SAJ7`	Arabidopsis thaliana	sp\|Q9SAJ7\|MTP9_ARATH Metal tolerance protein 9	61.100%	Swiss-Prot	High
`Q5NA18`	Oryza sativa subsp. japonica	sp\|Q5NA18\|MTP5_ORYSJ Metal tolerance protein 5	79.500%	Swiss-Prot	High
`Q0DHJ5`	Oryza sativa subsp. japonica	sp\|Q0DHJ5\|MTP6_ORYSJ Metal tolerance protein 6	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card