LXL04_035015 | RubberDandelionOmics

Gene overview

LXL04_035015

Reference: OH-1004 Chr: Chr08 Coordinates: 11319345-11321441 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · LXL04_035015|LXL04_035015|OH1004|cDNA

ATGGTGGAACCAATGAGTGGCGTTGAAGATCACGGTGGCTCTGAGGAGGAATTTCTGTTAACGGAGGTAAATATAGGCGGCGGCGGTGGAAGTACCGGTGCTTGTGACGTGTCATGGCGGTTGAACTTCGACGGGTTTCAATTCTCGTCGGAACATAAAGAGAAACCGCCTCGAGGTTTCCATGACTGCCTTGGGGTTTTAGGTCCAGAAGACAATGTAGCAGAGTATTACCAACAGCAGGTAGAGATGCTGGAGGGCTT...

CDS

Download CDS FASTA

1221 bp · LXL04_035015|LXL04_035015|OH1004|CDS

ATGGTGGAACCAATGAGTGGCGTTGAAGATCACGGTGGCTCTGAGGAGGAATTTCTGTTAACGGAGGTAAATATAGGCGGCGGCGGTGGAAGTACCGGTGCTTGTGACGTGTCATGGCGGTTGAACTTCGACGGGTTTCAATTCTCGTCGGAACATAAAGAGAAACCGCCTCGAGGTTTCCATGACTGCCTTGGGGTTTTAGGTCCAGAAGACAATGTAGCAGAGTATTACCAACAGCAGGTAGAGATGCTGGAGGGCTT...

Protein

Download Protein FASTA

406 aa · LXL04_035015|LXL04_035015|OH1004|PROTEIN

MVEPMSGVEDHGGSEEEFLLTEVNIGGGGGSTGACDVSWRLNFDGFQFSSEHKEKPPRGFHDCLGVLGPEDNVAEYYQQQVEMLEGFTEMDALAERGFVPRLSEEEKACLARRETLAIRISNIANMILFIAKVYASIKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKRRMQPLGILVFASVMATLGLQIILESVRTLASNEKDFNLTKEQEEWVIGIMLSVTLVKLVLCIYCRSFTNEIVKAYAQDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035015`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035015

Location Chr08:11319345-11321441 (+)

Description Similar to MTP5: Metal tolerance protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39450`	Cation/proton antiporter involved in endogenous manganese tolerance probably through vesicular trafficking and exocytosis.	A secretory pathway-localized cation diffusion facilitator confers plant manganese tolerance.2007 · DOI: 10.1073/pnas.0609507104 A role for the AtMTP11 gene of Arabidopsis in manganese transport and tolerance.2007 · DOI: 10.1111/j.1365-313x.2007.03138.x
`At1g16310`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release
`At1g79520`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837800`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release
`Os05g0461900`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035015 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010042 response to manganese ion Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0046688 response to copper ion Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:2000031 regulation of salicylic acid mediated signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16310

ath:AT1G79520

ath:AT2G39450

dosa:Os01g0837800

dosa:Os05g0461900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.320

Rank 1 · LXL04_035015 · OH-1004

Golgi apparatus0.300

Rank 2 · LXL04_035015 · OH-1004

Lysosome / Vacuole0.261

Rank 3 · LXL04_035015 · OH-1004

Endoplasmic reticulum0.216

Rank 4 · LXL04_035015 · OH-1004

Cell membrane0.212

Rank 5 · LXL04_035015 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01545.27Cation_efflux120-312 aa

PF16916.12ZT_dimer323-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035015	`PF01545.27`	Cation_efflux	120	312	3e-30	106.2
LXL04_035015	`PF16916.12`	ZT_dimer	323	392	9.8e-08	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80632`	Arabidopsis thaliana	Metal tolerance protein 11	80.542%	Swiss-Prot	strong database homology
`Q0WU02`	Arabidopsis thaliana	Metal tolerance protein 10	60.916%	Swiss-Prot	strong database homology
`Q9SAJ7`	Arabidopsis thaliana	Metal tolerance protein 9	61.081%	Swiss-Prot	strong database homology
`Q5NA18`	Oryza sativa subsp. japonica	Metal tolerance protein 5	80.108%	Swiss-Prot	strong database homology
`Q0DHJ5`	Oryza sativa subsp. japonica	Metal tolerance protein 6	69.919%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card