TkA04G166730 | RubberDandelionOmics

Gene overview

TkA04G166730

Reference: TK1151 Chr: Chr04 Coordinates: 43093041-43093364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA04G166730|TK1151|cDNA

ATGTTAGACCCAGTCAAATCGGAACACATGAAGGCAGATAGCAAAATCGGAACAACTCTATACCTGATGTTAGACCCAGTCAAATCGGAACACATGAAGGCAGATAGCAAAATCGGAACAACCTCACCTCCAGCGGCTACCGGATTTCCCCAGATTCTGCAGACCTCTTCTTCCCAACATTTCCCTCTCATCTCTCTCAAGGAAATCAGAATCCATCCACCTGCTTCATCCCTTCTCGCCGACGTGAGCTTCTACAGTCG...

CDS

Download CDS FASTA

324 bp · TkA04G166730|TK1151|CDS

ATGTTAGACCCAGTCAAATCGGAACACATGAAGGCAGATAGCAAAATCGGAACAACTCTATACCTGATGTTAGACCCAGTCAAATCGGAACACATGAAGGCAGATAGCAAAATCGGAACAACCTCACCTCCAGCGGCTACCGGATTTCCCCAGATTCTGCAGACCTCTTCTTCCCAACATTTCCCTCTCATCTCTCTCAAGGAAATCAGAATCCATCCACCTGCTTCATCCCTTCTCGCCGACGTGAGCTTCTACAGTCG...

Protein

Download Protein FASTA

107 aa · TkA04G166730|TK1151|PROTEIN

MLDPVKSEHMKADSKIGTTLYLMLDPVKSEHMKADSKIGTTSPPAATGFPQILQTSSSQHFPLISLKEIRIHPPASSLLADVSFYSRRSRRNSPRRRRRYHRIAFER

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G166730`
TK1151 ID	TkA04G166730
OH-1004 ID	LXL04_020949
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 97.196 / OH-1004 13.506 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G166730`
Location	Chr04:43093041-43093364 (+)
Description	Similar to At1g50920: Nucleolar GTP-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020949` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0008156 negative regulation of DNA replication Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0022408 negative regulation of cell-cell adhesion Biological Process GO:0030336 negative regulation of cell migration Biological Process GO:0031397 negative regulation of protein ubiquitination Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:0050821 protein stabilization Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G50920 hsa:23560 mmu:69237 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.444

Rank 1 · TkA04G166730 · TK1151

Cytoplasm0.414

Rank 2 · TkA04G166730 · TK1151

Cell membrane0.105

Rank 3 · TkA04G166730 · TK1151

Mitochondrion0.101

Rank 4 · TkA04G166730 · TK1151

Endoplasmic reticulum0.067

Rank 5 · TkA04G166730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07097DUF13592-20 aa

PF07097DUF135922-40 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G166730	`PF07097`	DUF1359	2	20	0.37	11.7
TkA04G166730	`PF07097`	DUF1359	22	40	0.37	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card