LXL04_020949 | RubberDandelionOmics

Gene overview

LXL04_020949

Reference: OH-1004 Chr: Chr04 Coordinates: 116200535-116203278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2313 bp · LXL04_020949|LXL04_020949|OH1004|cDNA

ATGGTGCAGTACAACTTTAAGAAGATCACGCGAGTCCCAACGGGAAAAGACTTCGTCGACATCATCCTGAGCAGAACCCAAAGACAAACACCAACAGTCGTCCACAAAGGCTACGCCATAAACCGAATCCGCCAGTTTTACATGCGAAAAGTCAAATTCACCCAAACAAACTTCCACGAAAAGCTCTCCACCATCATCGACGAGTTCCCCAGACTCGACGACGTCCATCCTTTCTACGGCGACCTTCTCCACGTCCTCTA...

CDS

Download CDS FASTA

2313 bp · LXL04_020949|LXL04_020949|OH1004|CDS

ATGGTGCAGTACAACTTTAAGAAGATCACGCGAGTCCCAACGGGAAAAGACTTCGTCGACATCATCCTGAGCAGAACCCAAAGACAAACACCAACAGTCGTCCACAAAGGCTACGCCATAAACCGAATCCGCCAGTTTTACATGCGAAAAGTCAAATTCACCCAAACAAACTTCCACGAAAAGCTCTCCACCATCATCGACGAGTTCCCCAGACTCGACGACGTCCATCCTTTCTACGGCGACCTTCTCCACGTCCTCTA...

Protein

Download Protein FASTA

770 aa · LXL04_020949|LXL04_020949|OH1004|PROTEIN

MVQYNFKKITRVPTGKDFVDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVKFTQTNFHEKLSTIIDEFPRLDDVHPFYGDLLHVLYNKDHYKLALGQINTARNLISKIAKDYVKLLKYGDSLYRCKALKVAALGRMCTVTKRIGPSLAYLEQIRQHMARLPSIDPNTRTILICGYPNVGKSSFINKITRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRAAVLFFLDISGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020949`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020949

Location Chr04:116200535-116203278 (-)

Description Similar to At1g50920: Nucleolar GTP-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50920`	Involved in the biogenesis of the 60S ribosomal subunit.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020949 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0008156 negative regulation of DNA replication Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0022408 negative regulation of cell-cell adhesion Biological Process

GO:0030336 negative regulation of cell migration Biological Process

GO:0031397 negative regulation of protein ubiquitination Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G50920

hsa:23560

mmu:69237

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.903

Rank 1 · LXL04_020949 · OH-1004

Cytoplasm0.149

Rank 2 · LXL04_020949 · OH-1004

Mitochondrion0.030

Rank 3 · LXL04_020949 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_020949 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_020949 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17835.7NOG1_N6-165 aa

PF02421.25FeoB_N170-319 aa

PF01926.30MMR_HSR1171-290 aa

PF06858.21NOG1236-292 aa

PF08155.17NOGCT409-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020949	`PF17835.7`	NOG1_N	6	165	1.2e-59	201.8
LXL04_020949	`PF02421.25`	FeoB_N	170	319	1.6e-11	44.7
LXL04_020949	`PF01926.30`	MMR_HSR1	171	290	8.4e-19	68.5
LXL04_020949	`PF06858.21`	NOG1	236	292	6.8e-25	87.3
LXL04_020949	`PF08155.17`	NOGCT	409	462	7.1e-27	93.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6I8`	Arabidopsis thaliana	Nucleolar GTP-binding protein 1	76.444%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card