TkA04G156200 | RubberDandelionOmics

Gene overview

TkA04G156200

Reference: TK1151 Chr: Chr04 Coordinates: 40423887-40426137 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1151 bp · TkA04G156200|TK1151|cDNA

TCACTTTTAGGCATCGCCGATGGATACAATGAGCGGGAGGCGTGCGTGATGTTTTTATTCTCTTAAACCAGTCTTCTCGATAAACTCCTTTAATCGATTCCGGTTCCTGACGATTCAACATTGTATAATCGGTTTAAGTAATCTATTTGAAATCGATTTCATGCTTAATCGGTTCATACCATACACGCGTAGAATACACACGGTTTCGTTTTTGAAATTCGTTTAATCGTTTCTGTTTTGGATTTTGTTTAAAGAAGTCG...

CDS

Download CDS FASTA

447 bp · TkA04G156200|TK1151|CDS

ATGAAGCATCTTGATGTAGCTGGTGGGACAGGAGATGTGGCTTTCAGGATTCTTGAAACTGTCAACAGTGTGAATCGAAGAGCGATAGCAGACACACTTGAAGATGATTTACAGCAAGAAACTCAGATTTATGTCTATGATATAAATCCAAACATGTTGGATGTTGGGCTTGGAGAACAAGGGTCCCTGATTTGGGTTGAAGGAGATGCAGAAAAACTCAATTTTGAAGATAATTCAATGGATGGTTACACAATTGCTTT...

Protein

Download Protein FASTA

148 aa · TkA04G156200|TK1151|PROTEIN

MKHLDVAGGTGDVAFRILETVNSVNRRAIADTLEDDLQQETQIYVYDINPNMLDVGLGEQGSLIWVEGDAEKLNFEDNSMDGYTIAFGIRNVTHIEKVLAKAYRVLKKGGRFLCLELSHVEAPVFKQVYDYYSFSVIPVLGELVVGDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G156200`
TK1151 ID	TkA04G156200
OH-1004 ID	LXL04_017945
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.700
Protein coverage (%)	TK1151 100.000 / OH-1004 53.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G156200

Location Chr04:40423887-40426137 (+)

Description Similar to COQ5: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57300`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0976600`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017945 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0008425 2-methoxy-6-polyprenyl-1,4-benzoquinol methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57300

bta:533208

dosa:Os01g0976600

gga:416975

hsa:84274

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.288

Rank 1 · TkA04G156200 · TK1151

Cytoplasm0.250

Rank 2 · TkA04G156200 · TK1151

Mitochondrion0.153

Rank 3 · TkA04G156200 · TK1151

Peroxisome0.133

Rank 4 · TkA04G156200 · TK1151

Lysosome / Vacuole0.107

Rank 5 · TkA04G156200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13847Methyltransf_311-128 aa

PF01209Ubie_methyltran2-146 aa

PF13649Methyltransf_254-22 aa

PF08242Methyltransf_124-112 aa

PF29470Ccs4_C25-48 aa

PF13649Methyltransf_2536-110 aa

PF08241Methyltransf_1140-114 aa

PF20922Anamorsin_N60-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G156200	`PF13847`	Methyltransf_31	1	128	8.7e-07	29.5
TkA04G156200	`PF01209`	Ubie_methyltran	2	146	1e-38	133.7
TkA04G156200	`PF13649`	Methyltransf_25	4	22	8.9e-12	46.3
TkA04G156200	`PF08242`	Methyltransf_12	4	112	1.4e-06	29.6
TkA04G156200	`PF29470`	Ccs4_C	25	48	0.097	13.9
TkA04G156200	`PF13649`	Methyltransf_25	36	110	8.9e-12	46.3
TkA04G156200	`PF08241`	Methyltransf_11	40	114	1.1e-13	52.4
TkA04G156200	`PF20922`	Anamorsin_N	60	76	0.22	11.9
TkA04G156200	`PF05148`	Methyltransf_8	68	117	0.11	13.1
TkA04G156200	`PF20922`	Anamorsin_N	91	116	0.22	11.9
TkA04G156200	`PF29470`	Ccs4_C	93	107	0.097	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVC8`	Arabidopsis thaliana	sp\|Q9LVC8\|COQ5_ARATH 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	72.400%	Swiss-Prot	High
`Q5JNC0`	Oryza sativa subsp. japonica	sp\|Q5JNC0\|COQ5_ORYSJ 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	70.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card