Gene Card
Gene overview
cDNA / CDS / Protein Sequences
408 bp · TkA04G141850|TK1151|cDNA
ATGTTTCAAGGTTTAGCAAAGGACCGCCTTCAGTCCTTGAATTCATCTCCTTCTGCAACTCCCCGCGTTCCCTTCTATATTCTAAAATCTAACCTACTACTACTTGCAGAGTTGCAGATAAGGATATGTGTGCTTATTTACCATACAACACCATCACCTCTGTATTTGTTATTATTCTTTGAGCCTTTTAGTATTGCTTACAAGACACTACAGGCCATTTTGGTGCATGGATTTCAACTGCTTGATATATGGAAATATCA...
408 bp · TkA04G141850|TK1151|CDS
ATGTTTCAAGGTTTAGCAAAGGACCGCCTTCAGTCCTTGAATTCATCTCCTTCTGCAACTCCCCGCGTTCCCTTCTATATTCTAAAATCTAACCTACTACTACTTGCAGAGTTGCAGATAAGGATATGTGTGCTTATTTACCATACAACACCATCACCTCTGTATTTGTTATTATTCTTTGAGCCTTTTAGTATTGCTTACAAGACACTACAGGCCATTTTGGTGCATGGATTTCAACTGCTTGATATATGGAAATATCA...
Protein
Download Protein FASTA135 aa · TkA04G141850|TK1151|PROTEIN
MFQGLAKDRLQSLNSSPSATPRVPFYILKSNLLLLAELQIRICVLIYHTTPSPLYLLLFFEPFSIAYKTLQAILVHGFQLLDIWKYHSAGITTNSKMSKLIGISSAGKQDEDLYFMMVVFWNLEVSAIILTFDCL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G141850 |
|---|---|
| TK1151 ID | TkA04G141850 |
| OH-1004 ID | LXL04_027065 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 60.600 |
| Protein coverage (%) | TK1151 79.259 / OH-1004 18.891Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G141850 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:36670498-36671068 (+) | |||||||||
| Description | Similar to RIN2: E3 ubiquitin protein ligase RIN2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0034052 positive regulation of plant-type hypersensitive response Biological Process GO:0036503 ERAD pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:1904276 regulation of wax biosynthetic process Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G65040 ath:AT3G16090 ath:AT4G25230 ath:AT5G51450 dosa:Os06g0301000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.