TkA04G140590 | RubberDandelionOmics

Gene overview

TkA04G140590

Reference: TK1151 Chr: Chr04 Coordinates: 36363344-36372939 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7264 bp · TkA04G140590|TK1151|cDNA

ATGACCCGGTTTTTTGTTTTAATGGAGTCCTCTTCGTGTTCTGTACAACATTTTTCTTCGTGAGATCTCCGGGTGGAAAACCACCAGATTTTCATTCTGTAGAGCAGCAGTAACAGTAGCAAATTGTTAATATAGTCAAATGGAGATCGAGGAAGAAAGGGGAAGTGTTCCTCAAGTTCTCTACGAGACTCGTCATCATGCTTCTAGACCTTACTCTTCAAATTACCCTCCTGTTCATCAGCAGCTAAATGAAGGCACTA...

CDS

Download CDS FASTA

5709 bp · TkA04G140590|TK1151|CDS

ATGGAAAAATACAAGCAGTTTGACTCTGTTAAGTTGCAATGGAGCTTGATTTCATTTGCAAAAAGATCCGTTTCAGAACTTTATGATATTTTTATCAGGAAGAAGCAGTTTCAGGCAGCATTAGAGTTAGCTGATACTCATAAGTTGGATAAAGATGAAGTTTTGAAAGCACAGTGGCTGTGTTCTTTACAGGGGACTAGTGAAATCAAGAGTTTACTTTCGCGCATTAAGGATCAAGATTTTGTACTTTCGGAGTGTGT...

Protein

Download Protein FASTA

1902 aa · TkA04G140590|TK1151|PROTEIN

MEKYKQFDSVKLQWSLISFAKRSVSELYDIFIRKKQFQAALELADTHKLDKDEVLKAQWLCSLQGTSEIKSLLSRIKDQDFVLSECVDRVGPTEDAVRGLLSYGLQLTNRYMFGDVEDEEGSPSWDFRLARLKMLQFRDRLETFLGINMGRFSAQDYTKFRSLPINESAIALAESGKIGALNLLFKRHPFSISPSMLQILSAIPETVPVQTYTQLLPATSPPQVTALREEDWVESKKMVNYINTLPKPDSQIKTEPIVKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G140590`
TK1151 ID	TkA04G140590
OH-1004 ID	LXL04_035377
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 82.266 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G140590

Location Chr04:36363344-36372939 (+)

Description Similar to MIP2: MAG2-interacting protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24350`	Required for proper maturation of seed storage proteins.	MAG2 and three MAG2-INTERACTING PROTEINs form an ER-localized complex to facilitate storage protein transport in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12347

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035377 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006624 vacuolar protein processing Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0015031 protein transport Biological Process

GO:0032527 protein exit from endoplasmic reticulum Biological Process

GO:0051604 protein maturation Biological Process

GO:2000623 negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT5G24350

dre:556592

hsa:51594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · TkA04G140590 · TK1151

Cytoplasm0.370

Rank 2 · TkA04G140590 · TK1151

Golgi apparatus0.079

Rank 3 · TkA04G140590 · TK1151

Cell membrane0.067

Rank 4 · TkA04G140590 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA04G140590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24520ARM_KNTC1_1st32-226 aa

PF08314Sec39169-375 aa

PF01752Peptidase_M9228-358 aa

PF08314Sec39491-712 aa

PF24520ARM_KNTC1_1st646-687 aa

PF26751All-alpha_MIP21228-1557 aa

PF26752MIP2_C1573-1900 aa

PF08314Sec391609-1696 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G140590	`PF24520`	ARM_KNTC1_1st	32	226	1e-13	52.4
TkA04G140590	`PF08314`	Sec39	169	375	5.6e-30	105.2
TkA04G140590	`PF01752`	Peptidase_M9	228	358	0.32	11.0
TkA04G140590	`PF08314`	Sec39	491	712	5.6e-30	105.2
TkA04G140590	`PF24520`	ARM_KNTC1_1st	646	687	1e-13	52.4
TkA04G140590	`PF26751`	All-alpha_MIP2	1228	1557	1.8e-121	405.9
TkA04G140590	`PF26752`	MIP2_C	1573	1900	3e-107	359.1
TkA04G140590	`PF08314`	Sec39	1609	1696	5.6e-30	105.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIN7`	Arabidopsis thaliana	sp\|Q9FIN7\|MIP2_ARATH MAG2-interacting protein 2	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card