Gene Card
Gene overview
cDNA / CDS / Protein Sequences
771 bp · TkA04G134940|TK1151|cDNA
TGGAGACGGAGCACGTTGCCGTTGCCCATGGAGGTCAAAACGTGCGTGCTGCGGAGCTACATTTATACTCAACCTCCGTTCATGTCTTTCTACGTGCTTATTCGTATCCAGAAGAGAGAAAGACAGAGAGACAGAGACAGAGTGTCTTCATCGGTGCAGATAAATAAATGGCGTCAAATCGCAAAACATTCGTCTTTGCTGAAGTCGCTAAGCACGACAGAGTTGATGACTGCTGGCTAATTATAGCCGGAAAGGTTTAT...
399 bp · TkA04G134940|TK1151|CDS
ATGGCGTCAAATCGCAAAACATTCGTCTTTGCTGAAGTCGCTAAGCACGACAGAGTTGATGACTGCTGGCTAATTATAGCCGGAAAGGTTTATGATGTGACGACGTTTATGGATGATCACCCTGGCGGCCAAGAACCTCTCCTAGCAGCAGCTTGCAAAGATGGGACAAAAGATTTCGAAGTTATTGGGCACAGTGATGACGCTAAAGAAATGATGAAAAAGTATGAAATTGGTGACGTTGACCAGTCAACTGTTCCTTT...
Protein
Download Protein FASTA132 aa · TkA04G134940|TK1151|PROTEIN
MASNRKTFVFAEVAKHDRVDDCWLIIAGKVYDVTTFMDDHPGGQEPLLAAACKDGTKDFEVIGHSDDAKEMMKKYEIGDVDQSTVPLEHTTDPSMDFSYQAERGRQSFPQMLQILVPLVIIGVAFTIKIYTT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G134940 |
|---|---|
| TK1151 ID | TkA04G134940 |
| OH-1004 ID | LXL04_021569 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 53.400 |
| Protein coverage (%) | TK1151 99.242 / OH-1004 96.324Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G134940 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:35105052-35107078 (-) | ||||||||||||
| Description | Similar to CYB5: Cytochrome b5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0043447 alkane biosynthetic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0020037 heme binding Molecular Function GO:0046872 metal ion binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G32720 ath:AT5G53560 dosa:Os05g0108800 nta:107781159 nta:107816859 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00173Cyt-b511-80 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G134940 | PF00173 | Cyt-b5 | 11 | 80 | 2.6e-27 | 95.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.