LXL04_021569 | RubberDandelionOmics

Gene overview

LXL04_021569

Reference: OH-1004 Chr: Chr04 Coordinates: 132536940-132537764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_021569|LXL04_021569|OH1004|cDNA

ATGGCGTCAGATCCGAAAAACTTCGTATTCGAAGATGTTATCAAACACAACAAAACCAAGGACTGCTGGCTTGTAATCGATGGAAAGGTTTATGATGTAACTCCTTTCATGGAAGATCACCCTGGAGGTGATGAAGTTCTGCTAGCAGCAACTGGGAAAGATGCAACAGACGATTTTGAGGATGTGGGGCACAGTGATGATGCTAGAGGTATGATGCACAAATACTACATTGGCGAAATAGACAGGGAAACTGTTCCTAA...

CDS

Download CDS FASTA

411 bp · LXL04_021569|LXL04_021569|OH1004|CDS

ATGGCGTCAGATCCGAAAAACTTCGTATTCGAAGATGTTATCAAACACAACAAAACCAAGGACTGCTGGCTTGTAATCGATGGAAAGGTTTATGATGTAACTCCTTTCATGGAAGATCACCCTGGAGGTGATGAAGTTCTGCTAGCAGCAACTGGGAAAGATGCAACAGACGATTTTGAGGATGTGGGGCACAGTGATGATGCTAGAGGTATGATGCACAAATACTACATTGGCGAAATAGACAGGGAAACTGTTCCTAA...

Protein

Download Protein FASTA

136 aa · LXL04_021569|LXL04_021569|OH1004|PROTEIN

MASDPKNFVFEDVIKHNKTKDCWLVIDGKVYDVTPFMEDHPGGDEVLLAATGKDATDDFEDVGHSDDARGMMHKYYIGEIDRETVPKKRAYVKPADSNYNHDKTSEFVIKILQFIVPLVILGLAFVVRSYTKEKSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021569`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021569

Location Chr04:132536940-132537764 (-)

Description Similar to CYB5: Cytochrome b5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53560`	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases, including fatty acid desaturases.	No verified direct reference in this release
`At2g32720`	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases, including fatty acid desaturases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0108800`	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021569 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0043447 alkane biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G32720

ath:AT5G53560

dosa:Os05g0108800

nta:107781159

nta:107816859

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.505

Rank 1 · LXL04_021569 · OH-1004

Mitochondrion0.192

Rank 2 · LXL04_021569 · OH-1004

Cytoplasm0.135

Rank 3 · LXL04_021569 · OH-1004

Plastid0.083

Rank 4 · LXL04_021569 · OH-1004

Nucleus0.074

Rank 5 · LXL04_021569 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00173.34Cyt-b511-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021569	`PF00173.34`	Cyt-b5	11	80	1.3e-29	102.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42342`	Arabidopsis thaliana	Cytochrome b5 isoform E	72.180%	Swiss-Prot	strong database homology
`O48845`	Arabidopsis thaliana	Cytochrome b5 isoform B	63.636%	Swiss-Prot	strong database homology
`P49100`	Oryza sativa subsp. japonica	Cytochrome b5	62.044%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card