RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G130920
Reference: TK1151 Chr: Chr04 Coordinates: 34128725-34133118 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4141 bp · TkA04G130920|TK1151|cDNA

CTGAAAGTTGTGGTGGGCCCTGTTAGGAATTTTGTTCGATCTACTCAAATACGTGGTCATGTTCATGTCAATAATAAGTTAATAAGTTTGACTGAAGTAAATTAGTGTTGTAATGGGCCCATTAAGACTCATGAACTTATTTAAAAAAATATGGCGGTGATCGTGGGAAGATAGATAATGGTCACCGGTTTCGAAGGAAAGAAAGAAGAAATGGTAATTTTGCAATGACGCGTACATACATGGCTTCACGTTCACATGTG...

CDS

Download CDS FASTA

3438 bp · TkA04G130920|TK1151|CDS

ATGGCGTCCAAGTCATTCAAAGCGACTCGCTCAAATCTATCGATAAGCTCCGATGCTACGGATTCACAGCCTAATAAACCTCCATTGCCGCCGACTGTCACATTCGCCCGCCGGACTTCATCGGGGAGATATGTAAATTATTCAAGGGACGATCTCGACAGTGAACTCGGAAGTCAGGATTTCATGAACTACACAGTCCACCTACCGCCAACTCCCGACAACCAGCCAATGGATGCGATTTCCCAGAAGGTTGAAGAACA...

Protein

Download Protein FASTA

1145 aa · TkA04G130920|TK1151|PROTEIN

MASKSFKATRSNLSISSDATDSQPNKPPLPPTVTFARRTSSGRYVNYSRDDLDSELGSQDFMNYTVHLPPTPDNQPMDAISQKVEEQYVSSSLFTGGFNAVTRAHLMDKVIDSEINHPQMAGAKGSSCSVPGCDAKVMSDERGADILPCECDFKICRDCYLDAIKTGDGICPGCKEQYKTTDLDELVVDNGTRPLPLPPPAGMSKNERRLSLMKSTKSVLMRSQTGDFDHNRWLFETSGTYGYGNAIWPKEGVMENGKDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G130920
TK1151 IDTkA04G130920
OH-1004 IDLXL04_035439
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G130920
LocationChr04:34128725-34133118 (+)
DescriptionSimilar to CSLD3: Cellulose synthase-like protein D3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g03050 Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.
AtCSLD3, a cellulose synthase-like gene important for root hair growth in arabidopsis.2001 · DOI: 10.1104/pp.126.2.575
At5g16910 Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YU42 Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall. No verified direct reference in this release
Os06g0111800 Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall. No verified direct reference in this release
UniProt: A2ZAK8 Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035439 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009409 response to cold Biological Process
GO:0009833 plant-type primary cell wall biogenesis Biological Process
GO:0030244 cellulose biosynthetic process Biological Process
GO:0048767 root hair elongation Biological Process
GO:0071555 cell wall organization Biological Process
GO:0071669 plant-type cell wall organization or biogenesis Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005768 endosome Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT3G03050
ath:AT5G16910
dosa:Os06g0111800
dosa:Os10g0578200
osa:4339895
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.567
Rank 1 · TkA04G130920 · TK1151
Endoplasmic reticulum0.193
Rank 2 · TkA04G130920 · TK1151
Golgi apparatus0.136
Rank 3 · TkA04G130920 · TK1151
Cytoplasm0.135
Rank 4 · TkA04G130920 · TK1151
Lysosome / Vacuole0.086
Rank 5 · TkA04G130920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569zf-UDP127-180 aa
PF14570zf-RING_4130-179 aa
PF13641Glyco_tranf_2_3375-415 aa
PF03552Cellulose_synt377-1136 aa
PF13632Glyco_trans_2_3632-714 aa
PF13632Glyco_trans_2_3835-963 aa
PF13641Glyco_tranf_2_3843-892 aa
PF29279YLL006W-A915-942 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G130920PF14569zf-UDP1271800.0002521.8
TkA04G130920PF14570zf-RING_41301798.2e-1864.7
TkA04G130920PF13641Glyco_tranf_2_33754150.01216.1
TkA04G130920PF03552Cellulose_synt37711361256.8
TkA04G130920PF13632Glyco_trans_2_36327145.7e-0627.0
TkA04G130920PF13632Glyco_trans_2_38359635.7e-0627.0
TkA04G130920PF13641Glyco_tranf_2_38438920.01216.1
TkA04G130920PF29279YLL006W-A9159420.3111.9
TkA04G130920PF13632Glyco_trans_2_3105911285.7e-0627.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M9M4Arabidopsis thalianasp|Q9M9M4|CSLD3_ARATH Cellulose synthase-like protein D383.700%Swiss-ProtHigh
Q9LFL0Arabidopsis thalianasp|Q9LFL0|CSLD2_ARATH Cellulose synthase-like protein D282.400%Swiss-ProtHigh
A2YU42Oryza sativa subsp. indicasp|A2YU42|CSLD2_ORYSI Cellulose synthase-like protein D281.000%Swiss-ProtHigh
Q9LHZ7Oryza sativa subsp. japonicasp|Q9LHZ7|CSLD2_ORYSJ Cellulose synthase-like protein D281.000%Swiss-ProtHigh
A2ZAK8Oryza sativa subsp. indicasp|A2ZAK8|CSLD1_ORYSI Cellulose synthase-like protein D176.200%Swiss-ProtHigh

JBrowse

View in Genome Browser