TkA04G126560 | RubberDandelionOmics

Gene overview

TkA04G126560

Reference: TK1151 Chr: Chr04 Coordinates: 32871691-32874019 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1390 bp · TkA04G126560|TK1151|cDNA

AAAAACACAGAGCTGCGATCCACTCATTCCGCCACGTCACTCCACCCCAAATCCTTAATACAAACTCTTTAATCCGTTAATTTCAACCGCCGACGATCGACGGACAATAAGTAGACATGCTTATTAGCTGCAGAGCAACTGTCGTCTCCGCTGCCGCACCTCAAAGATTTCTCTCTAATTTCACTCGCATTTCTTCAGTTTCGATCCCATCGACATTTGGTTCTTCCTTGATCAACAACGACCGCGAGAAGAATATCAAA...

CDS

Download CDS FASTA

855 bp · TkA04G126560|TK1151|CDS

ATGCTTATTAGCTGCAGAGCAACTGTCGTCTCCGCTGCCGCACCTCAAAGATTTCTCTCTAATTTCACTCGCATTTCTTCAGTTTCGATCCCATCGACATTTGGTTCTTCCTTGATCAACAACGACCGCGAGAAGAATATCAAAACTGCTCTGCGATGGAGTAACTACTCTACCAGAATGGATAAGAAGAAGAATCTAGATGTCACCTGCGCCGCCGCCTCCGTCCCTGCCCAGCCTCTGGAAAATGCCGATGCCCTAAT...

Protein

Download Protein FASTA

284 aa · TkA04G126560|TK1151|PROTEIN

MLISCRATVVSAAAPQRFLSNFTRISSVSIPSTFGSSLINNDREKNIKTALRWSNYSTRMDKKKNLDVTCAAASVPAQPLENADALIDSVETFIFDCDGVIWKGDSLIEGVPETLELLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLSVNEEEILHLLLLQLHIYNQLISQKTRRFYVIGEEGILIELGLAGFSYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCVRENPGCLFLLQTAMLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G126560`
TK1151 ID	TkA04G126560
OH-1004 ID	LXL04_035500
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 89.085 / OH-1004 67.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G126560

Location Chr04:32871691-32874019 (-)

Description Similar to PGLP1B: Phosphoglycolate phosphatase 1B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36700`	Photorespiratory enzyme that dephosphorylates the 2- phosphoglycolate produced by the RuBisCO oxygenation reaction.	Identification of the photorespiratory 2-phosphoglycolate phosphatase, PGLP1, in Arabidopsis.2007 · DOI: 10.1104/pp.107.099192
`At5g36790`	Photorespiratory enzyme that dephosphorylates the 2-phosphoglycolate produced by the RuBisCO oxygenation reaction.	No verified direct reference in this release
`At5g47760`	Dephosphorylates 2-phosphoglycolate, but does not contribute to photorespiratory metabolism.	Identification of the photorespiratory 2-phosphoglycolate phosphatase, PGLP1, in Arabidopsis.2007 · DOI: 10.1104/pp.107.099192

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035500 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0008967 phosphoglycolate phosphatase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G36700

ath:AT5G36790

ath:AT5G47760

pbe:PBANKA_1421300

pfa:PF3D7_0715000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · TkA04G126560 · TK1151

Mitochondrion0.046

Rank 2 · TkA04G126560 · TK1151

Cytoplasm0.030

Rank 3 · TkA04G126560 · TK1151

Nucleus0.022

Rank 4 · TkA04G126560 · TK1151

Peroxisome0.017

Rank 5 · TkA04G126560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase91-107 aa

PF13344Hydrolase_693-194 aa

PF00702Hydrolase106-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G126560	`PF00702`	Hydrolase	91	107	0.00036	21.7
TkA04G126560	`PF13344`	Hydrolase_6	93	194	1.1e-26	93.6
TkA04G126560	`PF00702`	Hydrolase	106	142	0.00036	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKC3`	Arabidopsis thaliana	sp\|P0DKC3\|PGP1A_ARATH Phosphoglycolate phosphatase 1A, chloroplastic	76.100%	Swiss-Prot	Medium
`P0DKC4`	Arabidopsis thaliana	sp\|P0DKC4\|PGP1B_ARATH Phosphoglycolate phosphatase 1B, chloroplastic	76.100%	Swiss-Prot	Medium
`Q8GWU0`	Arabidopsis thaliana	sp\|Q8GWU0\|PGP2_ARATH Phosphoglycolate phosphatase 2	59.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card