LXL04_035500 | RubberDandelionOmics

Gene overview

LXL04_035500

Reference: OH-1004 Chr: Chr08 Coordinates: 23721667-23723727 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · LXL04_035500|LXL04_035500|OH1004|cDNA

ATGCTTATTAGCTGCAGAGCAACTGTCGTCTCCGCTGCCGCACCTCAAAGATTTCTCTCTAATTTCACTCGCATTTCTTCAGTTTCGATCCCCTCGACATTTGGTTCTTCCTTGATCAACAACGACCGCGAGAAGAATATCAAAACTTCTCTGCGATGGAGTAACTACTCTACCAGAATGGATAAGAAGAAGAATCTAGATGTCACCTGCGCCGCCGCCTCCGTCCCTGCCCAGCCTCTGGAAAATGCCGATGCCCTAAT...

CDS

Download CDS FASTA

1122 bp · LXL04_035500|LXL04_035500|OH1004|CDS

ATGCTTATTAGCTGCAGAGCAACTGTCGTCTCCGCTGCCGCACCTCAAAGATTTCTCTCTAATTTCACTCGCATTTCTTCAGTTTCGATCCCCTCGACATTTGGTTCTTCCTTGATCAACAACGACCGCGAGAAGAATATCAAAACTTCTCTGCGATGGAGTAACTACTCTACCAGAATGGATAAGAAGAAGAATCTAGATGTCACCTGCGCCGCCGCCTCCGTCCCTGCCCAGCCTCTGGAAAATGCCGATGCCCTAAT...

Protein

Download Protein FASTA

373 aa · LXL04_035500|LXL04_035500|OH1004|PROTEIN

MLISCRATVVSAAAPQRFLSNFTRISSVSIPSTFGSSLINNDREKNIKTSLRWSNYSTRMDKKKNLDVTCAAASVPAQPLENADALIDSVETFIFDCDGVIWKGDSLIEGVPETLELLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLSVNEEEIFASSFAAAAYLQSIDFPKDKKIYVIGEEGILIELGLAGFSYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCVRENPGCLFLATNRDAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035500`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035500

Location Chr08:23721667-23723727 (+)

Description Similar to PGLP1B: Phosphoglycolate phosphatase 1B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36790`	Photorespiratory enzyme that dephosphorylates the 2-phosphoglycolate produced by the RuBisCO oxygenation reaction.	No verified direct reference in this release
`At5g36700`	Photorespiratory enzyme that dephosphorylates the 2- phosphoglycolate produced by the RuBisCO oxygenation reaction.	Identification of the photorespiratory 2-phosphoglycolate phosphatase, PGLP1, in Arabidopsis.2007 · DOI: 10.1104/pp.107.099192
`At5g47760`	Dephosphorylates 2-phosphoglycolate, but does not contribute to photorespiratory metabolism.	Identification of the photorespiratory 2-phosphoglycolate phosphatase, PGLP1, in Arabidopsis.2007 · DOI: 10.1104/pp.107.099192

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035500 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0008967 phosphoglycolate phosphatase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G36700

ath:AT5G36790

ath:AT5G47760

pbe:PBANKA_1421300

pfa:PF3D7_0715000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.963

Rank 1 · LXL04_035500 · OH-1004

Mitochondrion0.058

Rank 2 · LXL04_035500 · OH-1004

Cytoplasm0.040

Rank 3 · LXL04_035500 · OH-1004

Nucleus0.026

Rank 4 · LXL04_035500 · OH-1004

Peroxisome0.021

Rank 5 · LXL04_035500 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702.33Hydrolase91-330 aa

PF13344.13Hydrolase_693-194 aa

PF13242.13Hydrolase_like290-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035500	`PF00702.33`	Hydrolase	91	330	2.5e-14	54.9
LXL04_035500	`PF13344.13`	Hydrolase_6	93	194	2.5e-33	114.9
LXL04_035500	`PF13242.13`	Hydrolase_like	290	364	1.1e-21	77.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKC4`	Arabidopsis thaliana	Phosphoglycolate phosphatase 1B, chloroplastic	88.333%	Swiss-Prot	strong database homology
`P0DKC3`	Arabidopsis thaliana	Phosphoglycolate phosphatase 1A, chloroplastic	88.333%	Swiss-Prot	strong database homology
`Q8GWU0`	Arabidopsis thaliana	Phosphoglycolate phosphatase 2	67.708%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card