TkA04G119760 | RubberDandelionOmics

Gene overview

TkA04G119760

Reference: TK1151 Chr: Chr04 Coordinates: 31133620-31138602 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

874 bp · TkA04G119760|TK1151|cDNA

AAAGGAGAAAAGAAACATGGCTAAAAGCATCAGCTCTTGAAGACTACTCATGAGAATTTATATTTCACAAAATACGAAGCAATCTAAAATTTACCGATCTAATTTTCTGGATGTCGTATCCATACATGAACCCGACCCAAGACCGCAACCCATGAACTACCTTCAAAAACCCTAATTTTATAAGTATACACAAGTCTCAACTCCCGTGCGGCGGCCATAGCAGCACCTTATCGTACATTCTGTGCTTTGGAACCCTAGAA...

CDS

Download CDS FASTA

327 bp · TkA04G119760|TK1151|CDS

ATGGCACCGAAGAAAGAGAAGGCTCCCCCACCGTCATCTAAGCCGGCGAAATCCGGCGGTGGAAAACAGAAAAGAAGGAAGTGGAGCAAAGGAAAGCAAAAGGAGAAGGTGAACAACATGGTTTTATTCGACAAGGCAACGTACGATAAGCTTCTTACCGAAGCTCCAAAATTCAAGCTCATCACTCCTTCAATCTTGTCAGACAGACTAAGGATCAATGGATCATTGGCACGTAAGGCAATCAAGGATTTGATGGCAAG...

Protein

Download Protein FASTA

108 aa · TkA04G119760|TK1151|PROTEIN

MAPKKEKAPPPSSKPAKSGGGKQKRRKWSKGKQKEKVNNMVLFDKATYDKLLTEAPKFKLITPSILSDRLRINGSLARKAIKDLMARGAIRMVSAHASQQIYTRATNT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G119760`
TK1151 ID	TkA04G119760
OH-1004 ID	LXL04_001722
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G119760

Location Chr04:31133620-31138602 (+)

Description Similar to RPS25: 40S ribosomal protein S25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39200`	Small ribosomal subunit protein eS25w.	No verified direct reference in this release
`At2g21580`	Small ribosomal subunit protein eS25y.	No verified direct reference in this release
`At4g34555`	Small ribosomal subunit protein eS25x.	No verified direct reference in this release
`At2g16360`	Small ribosomal subunit protein eS25z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001722 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT2G21580

ath:AT4G34555

ath:AT4G39200

sly:544096

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.835

Rank 1 · TkA04G119760 · TK1151

Nucleus0.221

Rank 2 · TkA04G119760 · TK1151

Endoplasmic reticulum0.110

Rank 3 · TkA04G119760 · TK1151

Cell membrane0.054

Rank 4 · TkA04G119760 · TK1151

Mitochondrion0.022

Rank 5 · TkA04G119760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03297Ribosomal_S257-105 aa

PF18701DUF564123-48 aa

PF14394DUF442352-95 aa

PF12802MarR_255-91 aa

PF18701DUF564188-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G119760	`PF03297`	Ribosomal_S25	7	105	4.7e-40	136.6
TkA04G119760	`PF18701`	DUF5641	23	48	0.096	13.7
TkA04G119760	`PF14394`	DUF4423	52	95	0.085	13.4
TkA04G119760	`PF12802`	MarR_2	55	91	0.22	12.4
TkA04G119760	`PF18701`	DUF5641	88	106	0.096	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T029`	Arabidopsis thaliana	sp\|Q9T029\|RS254_ARATH Small ribosomal subunit protein eS25w	87.000%	Swiss-Prot	High
`Q9SIK2`	Arabidopsis thaliana	sp\|Q9SIK2\|RS252_ARATH Small ribosomal subunit protein eS25y	87.000%	Swiss-Prot	High
`Q8GYL5`	Arabidopsis thaliana	sp\|Q8GYL5\|RS253_ARATH Small ribosomal subunit protein eS25x	86.900%	Swiss-Prot	High
`Q9SIW5`	Arabidopsis thaliana	sp\|Q9SIW5\|RS251_ARATH Small ribosomal subunit protein eS25z	85.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card