LXL04_001722 | RubberDandelionOmics

Gene overview

LXL04_001722

Reference: OH-1004 Chr: Chr01 Coordinates: 32017244-32017942 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · LXL04_001722|LXL04_001722|OH1004|cDNA

ATGGCACCAAAGAAAGAGAAGGCTCCTCCACCGTCCTCCAAGCCCGCCAAATCCGGAGGTGGAAAACAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAAAGGAGAAGGTGAACAACATGGTCTTGTTCGATAAGGCTACTTATGACAAATTACTCACAGAGGCTCCTAAGTTTAAGCTTATCACCCCTTCCATTCTATCCGATCGTCTTAGGATCAATGGATCGCTTGCAAGGAAAGCAATTAAGGATTTGATGGCAAG...

CDS

Download CDS FASTA

327 bp · LXL04_001722|LXL04_001722|OH1004|CDS

ATGGCACCAAAGAAAGAGAAGGCTCCTCCACCGTCCTCCAAGCCCGCCAAATCCGGAGGTGGAAAACAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAAAGGAGAAGGTGAACAACATGGTCTTGTTCGATAAGGCTACTTATGACAAATTACTCACAGAGGCTCCTAAGTTTAAGCTTATCACCCCTTCCATTCTATCCGATCGTCTTAGGATCAATGGATCGCTTGCAAGGAAAGCAATTAAGGATTTGATGGCAAG...

Protein

Download Protein FASTA

108 aa · LXL04_001722|LXL04_001722|OH1004|PROTEIN

MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDKATYDKLLTEAPKFKLITPSILSDRLRINGSLARKAIKDLMARGAIRMVSAHASQQIYTRATNT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001722`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001722

Location Chr01:32017244-32017942 (-)

Description Similar to RPS25: 40S ribosomal protein S25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39200`	Small ribosomal subunit protein eS25w.	No verified direct reference in this release
`At2g21580`	Small ribosomal subunit protein eS25y.	No verified direct reference in this release
`At4g34555`	Small ribosomal subunit protein eS25x.	No verified direct reference in this release
`At2g16360`	Small ribosomal subunit protein eS25z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001722 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT2G21580

ath:AT4G34555

ath:AT4G39200

sly:544096

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.827

Rank 1 · LXL04_001722 · OH-1004

Nucleus0.227

Rank 2 · LXL04_001722 · OH-1004

Endoplasmic reticulum0.115

Rank 3 · LXL04_001722 · OH-1004

Cell membrane0.058

Rank 4 · LXL04_001722 · OH-1004

Golgi apparatus0.023

Rank 5 · LXL04_001722 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03297.22Ribosomal_S257-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001722	`PF03297.22`	Ribosomal_S25	7	105	4.3e-41	139.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T029`	Arabidopsis thaliana	Small ribosomal subunit protein eS25w	89.815%	Swiss-Prot	strong database homology
`Q9SIK2`	Arabidopsis thaliana	Small ribosomal subunit protein eS25y	89.815%	Swiss-Prot	strong database homology
`Q8GYL5`	Arabidopsis thaliana	Small ribosomal subunit protein eS25x	89.720%	Swiss-Prot	strong database homology
`Q9SIW5`	Arabidopsis thaliana	Small ribosomal subunit protein eS25z	88.679%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card