TkA04G116880 | RubberDandelionOmics

Gene overview

TkA04G116880

Reference: TK1151 Chr: Chr04 Coordinates: 30395591-30398847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1670 bp · TkA04G116880|TK1151|cDNA

AAAAAGCAACATCGGCCTATCACCTCTGTTTGCTTCTTTCTGTCCGTTTTCAAAACAGGGCTGTTTGAGCTTTGGAACATCCAAACAATCATTGGATTCCTAAGGTAAACATCCAATTTCACGTAAACGATCCCAACTCCTTATATAAATACTTCCAGATATACTTTCAAATCCTAGATTTACAAATTGCTTTTCTTTGGAGGTGAAAATTATCCATTAATCAGCTGAGACTTCTGGATTAATCAGGCCTTAAGAAGATG...

CDS

Download CDS FASTA

1293 bp · TkA04G116880|TK1151|CDS

ATGAGCTCCATAAGTGAAAATGTAGATAGGCTTACTTGCTTGCCTGATGAGATTATTTCACATATACTCTTTCTAATGCCAATAAGATTGGCGGTACAAACTAGCATTTTATCAAAAAGATGGAGGTACACTTGGATGTTGCTCAAAAAGCTTAATTTCGATGAATATCCCCGCCATGTCTTTGATAGAGATTCCATATCAAAATTTGTGGATATGGTATTAGAGCTATCTAAAACAACCCACATTGAACTATTCCGCTT...

Protein

Download Protein FASTA

430 aa · TkA04G116880|TK1151|PROTEIN

MSSISENVDRLTCLPDEIISHILFLMPIRLAVQTSILSKRWRYTWMLLKKLNFDEYPRHVFDRDSISKFVDMVLELSKTTHIELFRLKFTYIWARKSSVSKWINEAIRLNVRELNIQVLLLELPLSLFTCKTLTKLKLVESCYETGVLEVPSPVILPCLKTLDIRVRSKPSLNAFKLISGCSVLERLLLEVTWRNDEEEYSFSIPTLKRLEVRTLKCTSVINKVVLNVPNLEHFIVGGILCSLFVMEDLSNLVAATFSFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G116880`
TK1151 ID	TkA04G116880
OH-1004 ID	LXL04_035646
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 90.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G116880

Location Chr04:30395591-30398847 (+)

Description Similar to At4g10400: FBD-associated F-box protein At4g10400

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At4g15060`	Putative F-box/LRR-repeat protein At4g15060.	No verified direct reference in this release
`At3g50710`	Putative FBD-associated F-box protein At3g50710.	No verified direct reference in this release
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13780

ath:AT1G78750

ath:AT1G78760

ath:AT4G10400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.793

Rank 1 · TkA04G116880 · TK1151

Cytoplasm0.307

Rank 2 · TkA04G116880 · TK1151

Endoplasmic reticulum0.034

Rank 3 · TkA04G116880 · TK1151

Cell membrane0.034

Rank 4 · TkA04G116880 · TK1151

Plastid0.015

Rank 5 · TkA04G116880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-49 aa

PF24758LRR_At5g56370100-236 aa

PF24758LRR_At5g56370281-335 aa

PF08387FBD347-388 aa

PF24758LRR_At5g56370371-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G116880	`PF00646`	F-box	11	49	2.3e-05	24.9
TkA04G116880	`PF24758`	LRR_At5g56370	100	236	1.6e-09	38.5
TkA04G116880	`PF24758`	LRR_At5g56370	281	335	1.6e-09	38.5
TkA04G116880	`PF08387`	FBD	347	388	5.4e-09	36.5
TkA04G116880	`PF24758`	LRR_At5g56370	371	397	1.6e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	29.800%	Swiss-Prot	Low
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	27.000%	Swiss-Prot	Low
`O23360`	Arabidopsis thaliana	sp\|O23360\|FBL93_ARATH Putative F-box/LRR-repeat protein At4g15060	33.600%	Swiss-Prot	Medium
`Q9SCQ5`	Arabidopsis thaliana	sp\|Q9SCQ5\|FBD10_ARATH Putative FBD-associated F-box protein At3g50710	28.100%	Swiss-Prot	Low
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	26.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card