TkA04G115570 | RubberDandelionOmics

Gene overview

TkA04G115570

Reference: TK1151 Chr: Chr04 Coordinates: 30022614-30023607 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

503 bp · TkA04G115570|TK1151|cDNA

ATTCTCCCTTTTACATATTGTAATTGACTTTAAGACACAAAACATGTCCTCTCTCCCACGCCCACCTTCCCCCTCCCCTCTTCACCATGAAGCCGATGGATGATTTATGGAATGAGATCAGCGGCCTACCATCTCCGATCCCCAACCGCTTCCAAAACTTCTTTCCTCAGGCGCTTCGGTCGCCTGGAACCACCACTCAGTTCCTCCCTCCCCCGCCGTCCACCACCACCATGTTAACTCTACTCACGACTACCGACTCC...

CDS

Download CDS FASTA

417 bp · TkA04G115570|TK1151|CDS

ATGAAGCCGATGGATGATTTATGGAATGAGATCAGCGGCCTACCATCTCCGATCCCCAACCGCTTCCAAAACTTCTTTCCTCAGGCGCTTCGGTCGCCTGGAACCACCACTCAGTTCCTCCCTCCCCCGCCGTCCACCACCACCATGTTAACTCTACTCACGACTACCGACTCCGCGCATGAAGATCCCAATAAGAGACCTAAACCAAATCCACCACCGCAAAATCTTACGCCGGACGCCACTTCTCCACCTGAATACAC...

Protein

Download Protein FASTA

138 aa · TkA04G115570|TK1151|PROTEIN

MKPMDDLWNEISGLPSPIPNRFQNFFPQALRSPGTTTQFLPPPPSTTTMLTLLTTTDSAHEDPNKRPKPNPPPQNLTPDATSPPEYTEKFRRLMKNRESAARSRARKQARADELEQEVMRLAEENAKLKRLQKEVNYN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G115570`
TK1151 ID	TkA04G115570
OH-1004 ID	LXL04_035691
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G115570

Location Chr04:30022614-30023607 (-)

Description Similar to FD: Protein FD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41070`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter.	No verified direct reference in this release
`At4g35900`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At2g17770`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035691 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G45249

ath:AT2G17770

ath:AT2G41070

ath:AT4G35900

dosa:Os01g0859300

osa:4325061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA04G115570 · TK1151

Cytoplasm0.118

Rank 2 · TkA04G115570 · TK1151

Cell membrane0.022

Rank 3 · TkA04G115570 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA04G115570 · TK1151

Plastid0.010

Rank 5 · TkA04G115570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09487HrpB219-38 aa

PF14362DUF440765-134 aa

PF09487HrpB280-136 aa

PF14661HAUS6_N87-134 aa

PF25600TRIM_CC89-134 aa

PF00170bZIP_190-135 aa

PF07716bZIP_290-130 aa

PF03131bZIP_Maf90-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G115570	`PF09487`	HrpB2	19	38	0.49	11.6
TkA04G115570	`PF14362`	DUF4407	65	134	0.19	11.7
TkA04G115570	`PF09487`	HrpB2	80	136	0.49	11.6
TkA04G115570	`PF14661`	HAUS6_N	87	134	0.012	16.0
TkA04G115570	`PF25600`	TRIM_CC	89	134	0.65	10.6
TkA04G115570	`PF00170`	bZIP_1	90	135	4.6e-11	43.4
TkA04G115570	`PF07716`	bZIP_2	90	130	2.3e-10	41.1
TkA04G115570	`PF03131`	bZIP_Maf	90	130	0.00091	20.4
TkA04G115570	`PF14197`	Cep57_CLD_2	90	128	0.45	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5Q2`	Arabidopsis thaliana	sp\|Q9C5Q2\|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3	70.700%	Swiss-Prot	Low
`Q84JK2`	Arabidopsis thaliana	sp\|Q84JK2\|FD_ARATH Protein FD	65.900%	Swiss-Prot	Low
`Q7PCC6`	Arabidopsis thaliana	sp\|Q7PCC6\|FDP_ARATH bZIP transcription factor 27	63.400%	Swiss-Prot	Low
`Q9M7Q4`	Arabidopsis thaliana	sp\|Q9M7Q4\|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5	69.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card