TkA04G113480 | RubberDandelionOmics

Gene overview

TkA04G113480

Reference: TK1151 Chr: Chr04 Coordinates: 29435389-29439622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2614 bp · TkA04G113480|TK1151|cDNA

TTGGAATCCTTTTCCTTTCCAATGTCGCTTTCCTGCCAACCAAACGCCACCTAAGAAAACAATAAACCAGCGTCGTATTCTTTTTCACCAATCTCGCGTCGCGACTGCTTCAGCCATACTTCAGGCGTCGTTCACTCGTTCAGGTCGCACCACTCCCGACGCCCACCACCGACGCCCCTGATTTTCCCGCCAAAACTACATAGTGCGAAACAAATAGGGTGTTTGGACGCCCCCATCTGAGAATTACACAGTCAAATAAA...

CDS

Download CDS FASTA

2079 bp · TkA04G113480|TK1151|CDS

ATGGCACCGGCGGTAGCAGAGGATTTGTCTCTCCCCCATATTTCCGATAACGATCTCGAGCCATTCTTTGTGCTCCACAAAGCTTCTCCTCGCCAACACCATGCTAAAAAACCAGTAGGAAAGACACGCAGATCTGTTAAGGTTGACTTGTCAACATCATTAAATAACAGTAATAATCATGAAGCTGAAGGTCGAAATGATGAGTCACACGAAAACTTGAGAATGAAAAACTTCCACAATTCTTGGCTGACAATTGAATC...

Protein

Download Protein FASTA

692 aa · TkA04G113480|TK1151|PROTEIN

MAPAVAEDLSLPHISDNDLEPFFVLHKASPRQHHAKKPVGKTRRSVKVDLSTSLNNSNNHEAEGRNDESHENLRMKNFHNSWLTIESTIKDCMHNINADVFNEIDTWVHKSFDTICTSGRPDANKATCSYPIVTDVTAKQLFTALVVMNNMEFVDDLQTFADLGVHLNSHGCHVANLSSVDFSVKNGVGGCLRSLSRQILKSNIDAADISILASWYMEQENSNHPVVVIIEDMDRCSGPVLSDFILMLSEWVIKIPVMLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G113480`
TK1151 ID	TkA04G113480
OH-1004 ID	LXL04_035728
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G113480

Location Chr04:29435389-29439622 (+)

Description Similar to ORC3: Origin of replication complex subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16690`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0402200`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035728 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0009744 response to sucrose Biological Process

GO:0048527 lateral root development Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000785 chromatin Cellular Component

GO:0000808 origin recognition complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005656 nuclear pre-replicative complex Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

KEGG gene cross-reference

ath:AT5G16690

bta:523714

dosa:Os10g0402200

hsa:23595

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892

Rank 1 · TkA04G113480 · TK1151

Cytoplasm0.139

Rank 2 · TkA04G113480 · TK1151

Cell membrane0.043

Rank 3 · TkA04G113480 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA04G113480 · TK1151

Mitochondrion0.014

Rank 5 · TkA04G113480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09571RE_XcyI39-91 aa

PF07034ORC3_N51-353 aa

PF07034ORC3_N468-480 aa

PF18137WHD_ORC479-490 aa

PF18137WHD_ORC561-690 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G113480	`PF09571`	RE_XcyI	39	91	0.31	11.0
TkA04G113480	`PF07034`	ORC3_N	51	353	9.9e-57	193.5
TkA04G113480	`PF07034`	ORC3_N	468	480	9.9e-57	193.5
TkA04G113480	`PF18137`	WHD_ORC	479	490	4e-27	95.7
TkA04G113480	`PF18137`	WHD_ORC	561	690	4e-27	95.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6E7H0`	Arabidopsis thaliana	sp\|Q6E7H0\|ORC3_ARATH Origin of replication complex subunit 3	44.500%	Swiss-Prot	Medium
`Q0IY07`	Oryza sativa subsp. japonica	sp\|Q0IY07\|ORC3_ORYSJ Origin of replication complex subunit 3	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card