LXL04_035728 | RubberDandelionOmics

Gene overview

LXL04_035728

Reference: OH-1004 Chr: Chr08 Coordinates: 27739092-27742771 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2079 bp · LXL04_035728|LXL04_035728|OH1004|cDNA

ATGGCACCGGCGGTAGCAGAGGATTTGTCTCTCCCCCATATTTCCGATAACGATCTCGAGCCATTCTTTGTGCTCCACAAAGCTTCTCCTCGCCAACACCATGCTAAAAAACCAGTAGGAAAGACACGCAGATCTGTTAAGGTTGACTTGTCAACATCATTAAATAACAGTAATAATCATGAAGCTGAAGGTCCAAATGATGAGTCACACGAAAACTTGAGAATGAAAAACTTCCACAATTCTTGGCTGACAATTGAATC...

CDS

Download CDS FASTA

2079 bp · LXL04_035728|LXL04_035728|OH1004|CDS

ATGGCACCGGCGGTAGCAGAGGATTTGTCTCTCCCCCATATTTCCGATAACGATCTCGAGCCATTCTTTGTGCTCCACAAAGCTTCTCCTCGCCAACACCATGCTAAAAAACCAGTAGGAAAGACACGCAGATCTGTTAAGGTTGACTTGTCAACATCATTAAATAACAGTAATAATCATGAAGCTGAAGGTCCAAATGATGAGTCACACGAAAACTTGAGAATGAAAAACTTCCACAATTCTTGGCTGACAATTGAATC...

Protein

Download Protein FASTA

692 aa · LXL04_035728|LXL04_035728|OH1004|PROTEIN

MAPAVAEDLSLPHISDNDLEPFFVLHKASPRQHHAKKPVGKTRRSVKVDLSTSLNNSNNHEAEGPNDESHENLRMKNFHNSWLTIESTIKDCMHNINADVFNEIDTWVHKSFDTICTSGRPDANKATCSYPIVTDVTAKQLFTALVVMNNSEFVDDLQTFADLGVHLNSHGCHVANLSSVDFSVKNGVGGCLRSLSRQILKSNIDAADISILASWYMEQENSNHPVVVIIEDMDRCSGPVLSDFILMLSEWVIKIPVMLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035728`
TK1151 ID	TkA04G113480
OH-1004 ID	LXL04_035728
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035728

Location Chr08:27739092-27742771 (-)

Description Similar to ORC3: Origin of replication complex subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16690`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0402200`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035728 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0009744 response to sucrose Biological Process

GO:0048527 lateral root development Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000785 chromatin Cellular Component

GO:0000808 origin recognition complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005656 nuclear pre-replicative complex Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

KEGG gene cross-reference

ath:AT5G16690

bta:523714

dosa:Os10g0402200

hsa:23595

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · LXL04_035728 · OH-1004

Cytoplasm0.135

Rank 2 · LXL04_035728 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_035728 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_035728 · OH-1004

Plastid0.014

Rank 5 · LXL04_035728 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07034.18ORC3_N47-353 aa

PF18137.8WHD_ORC561-690 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035728	`PF07034.18`	ORC3_N	47	353	2.5e-57	195.5
LXL04_035728	`PF18137.8`	WHD_ORC	561	690	7.1e-27	94.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6E7H0`	Arabidopsis thaliana	Origin of replication complex subunit 3	43.983%	Swiss-Prot	moderate database homology
`Q0IY07`	Oryza sativa subsp. japonica	Origin of replication complex subunit 3	40.921%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card