TkA04G113450 | RubberDandelionOmics

Gene overview

TkA04G113450

Reference: TK1151 Chr: Chr04 Coordinates: 29429390-29430449 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

721 bp · TkA04G113450|TK1151|cDNA

CACCGCCATACCACAACATGTCTTCCTCCTCAATTCCTCCCACAACCACCGCCCCAATGGTGCTCCAACTGCTTCTCCTTCTGTTAACAACCACCTTCCTTCCATCTCCGACCATCGCCCAATCCAACTCCCCACAAAGCCCCACAATTTCAGAATGTGGGCCCCGTATCCTCCCCCTAGCTCTTTGTGCACCATTTGTTCAAGGCGTAACCAATACCCCCACTCAGTTATGTTGCGATAACTTGGTGAATGTCAATGAA...

CDS

Download CDS FASTA

612 bp · TkA04G113450|TK1151|CDS

ATGTCTTCCTCCTCAATTCCTCCCACAACCACCGCCCCAATGGTGCTCCAACTGCTTCTCCTTCTGTTAACAACCACCTTCCTTCCATCTCCGACCATCGCCCAATCCAACTCCCCACAAAGCCCCACAATTTCAGAATGTGGGCCCCGTATCCTCCCCCTAGCTCTTTGTGCACCATTTGTTCAAGGCGTAACCAATACCCCCACTCAGTTATGTTGCGATAACTTGGTGAATGTCAATGAACAACAGCCTCGTTGCTT...

Protein

Download Protein FASTA

203 aa · TkA04G113450|TK1151|PROTEIN

MSSSSIPPTTTAPMVLQLLLLLLTTTFLPSPTIAQSNSPQSPTISECGPRILPLALCAPFVQGVTNTPTQLCCDNLVNVNEQQPRCLCLLLNNSGLSSTFPINTTLAMQLPAMCSVNFDIVSCSGSPLPSMSPTPGVSLGSIINTTTNSTVASSPMATTTPKSPLMGIGFHDQNYAMNLRGSLQLRMMVVLTILTCISTSTFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G113450`
TK1151 ID	TkA04G113450
OH-1004 ID	LXL04_035729
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G113450

Location Chr04:29429390-29430449 (+)

Description Similar to YLS3: Protein YLS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73890`	Probable lipid transfer protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009625 response to insect Biological Process

GO:0010150 leaf senescence Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G27950

ath:AT1G55260

ath:AT1G73890

ath:AT2G44290

ath:AT2G44300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.788

Rank 1 · TkA04G113450 · TK1151

Endoplasmic reticulum0.105

Rank 2 · TkA04G113450 · TK1151

Cytoplasm0.075

Rank 3 · TkA04G113450 · TK1151

Extracellular0.053

Rank 4 · TkA04G113450 · TK1151

Nucleus0.051

Rank 5 · TkA04G113450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_235-123 aa

PF00234Tryp_alpha_amyl47-120 aa

PF00106adh_short73-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G113450	`PF14368`	LTP_2	35	123	4e-13	50.0
TkA04G113450	`PF00234`	Tryp_alpha_amyl	47	120	2e-09	38.3
TkA04G113450	`PF00106`	adh_short	73	156	0.025	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9B1`	Arabidopsis thaliana	sp\|Q9C9B1\|LTG10_ARATH Non-specific lipid transfer protein GPI-anchored 10	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card