LXL04_035729 | RubberDandelionOmics

Gene overview

LXL04_035729

Reference: OH-1004 Chr: Chr08 Coordinates: 27760408-27761372 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_035729|LXL04_035729|OH1004|cDNA

ATGTCTCCCTCCTCCATTCCTCCACCAACCTCCGCCCCAATGGTGCTCCAACTGCTTCTGCTTCTGTTAACAACCACCTTCCTTCCATCTCCGACCATCGCCCAATCCAACTCCCCACAAAGCCCCACAATTTCAGAATGTGGGCCCCGTATCCTCCCCCTAGCTCTTTGTGCACCATTTGTTCAAGGCGTAACCAATACCCCCACTCAGTTATGTTGCGATAACTTGGTGAATGTCAATGATCAACAGCCTCGTTGCTT...

CDS

Download CDS FASTA

612 bp · LXL04_035729|LXL04_035729|OH1004|CDS

ATGTCTCCCTCCTCCATTCCTCCACCAACCTCCGCCCCAATGGTGCTCCAACTGCTTCTGCTTCTGTTAACAACCACCTTCCTTCCATCTCCGACCATCGCCCAATCCAACTCCCCACAAAGCCCCACAATTTCAGAATGTGGGCCCCGTATCCTCCCCCTAGCTCTTTGTGCACCATTTGTTCAAGGCGTAACCAATACCCCCACTCAGTTATGTTGCGATAACTTGGTGAATGTCAATGATCAACAGCCTCGTTGCTT...

Protein

Download Protein FASTA

203 aa · LXL04_035729|LXL04_035729|OH1004|PROTEIN

MSPSSIPPPTSAPMVLQLLLLLLTTTFLPSPTIAQSNSPQSPTISECGPRILPLALCAPFVQGVTNTPTQLCCDNLVNVNDQQPRCLCLLLNNSGLSSTFPINTTLAMQLPAMCSVNFDIVSCSGSPLPSMSPTPGVSLGSIINTTTNSTVASSPMATTTPKSPLMGIGFHDQNYAMNLRGSLQLRMMVVLTILTCISTSTFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035729`
TK1151 ID	TkA04G113450
OH-1004 ID	LXL04_035729
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035729

Location Chr08:27760408-27761372 (-)

Description Similar to YLS3: Protein YLS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73890`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44290`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44300`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g55260`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At1g27950`	Lipid transfer protein that, together with LTPG2, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls.	Disruption of glycosylphosphatidylinositol-anchored lipid transfer protein gene altered cuticular lipid composition, increased plastoglobules, and enhanced susceptibility to infection by the fungal pathogen Alternaria brassicicola.2009 · DOI: 10.1104/pp.109.137745 Arabidopsis LTPG is a glycosylphosphatidylinositol-anchored lipid transfer protein required for export of lipids to the plant surface.2009 · DOI: 10.1105/tpc.108.064451 Characterization of glycosylphosphatidylinositol-anchored lipid transfer protein 2 (LTPG2) and overlapping function between LTPG/LTPG1 and LTPG2 in cuticular wax export or accumulation in Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcs083 Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035729 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009625 response to insect Biological Process

GO:0010150 leaf senescence Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G27950

ath:AT1G55260

ath:AT1G73890

ath:AT2G44290

ath:AT2G44300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.788

Rank 1 · LXL04_035729 · OH-1004

Endoplasmic reticulum0.106

Rank 2 · LXL04_035729 · OH-1004

Cytoplasm0.075

Rank 3 · LXL04_035729 · OH-1004

Extracellular0.053

Rank 4 · LXL04_035729 · OH-1004

Nucleus0.052

Rank 5 · LXL04_035729 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_235-123 aa

PF00234.28Tryp_alpha_amyl47-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035729	`PF14368.12`	LTP_2	35	123	3.6e-13	50.2
LXL04_035729	`PF00234.28`	Tryp_alpha_amyl	47	120	1.6e-09	38.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9B1`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 10	42.647%	Swiss-Prot	moderate database homology
`O64864`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 13	29.787%	Swiss-Prot	weak database homology
`O64865`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 14	30.588%	Swiss-Prot	weak database homology
`F4I082`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 6	29.167%	Swiss-Prot	weak database homology
`Q9C7F7`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 1	26.549%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card