TkA04G109560 | RubberDandelionOmics

Gene overview

TkA04G109560

Reference: TK1151 Chr: Chr04 Coordinates: 28480123-28483393 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2251 bp · TkA04G109560|TK1151|cDNA

AAAAGAAAAGAAAAGATAGGAAGGGGCGAAGGGCAAGAGGTCTCACTCTCGAGACTTGGTCCACAGTGCCACTAAAATATTTGTGCTTTTAACCCTCCAATGGAAGCACTAGCAGCATGAGTTCACGAGCGACCCACAACACACCATGGAATCAAATGCACATGAAGCAGTTGTGGATCATACAGTTTTAGTTCATCATTCAAACTAATAACCCCCAACTTTCCCTTCTTCTACTTCCACGCCTCATTCATCGATTCATT...

CDS

Download CDS FASTA

1785 bp · TkA04G109560|TK1151|CDS

ATGGCTAGGCGACATGGCTGGGAACTTCCTGCTCACACTTTTCAGGTTGTGGCTATTACAGTATTCTTCTTACTGTCGGTTGCCTTCTATGCATTCTTCTCACCTTTTCTCGGAAAGGACATCTACGAACATATAGCAATCGGTGTCTACTCCTTCTTGGCTCTCTGTGTCTTCATCCTTTATGTAAGATGCACAGCTATCGATCCAGCTGACCCCGGGATCCTAATCGAACCAGATAGGGCAATTGCATCACCTTATAG...

Protein

Download Protein FASTA

595 aa · TkA04G109560|TK1151|PROTEIN

MARRHGWELPAHTFQVVAITVFFLLSVAFYAFFSPFLGKDIYEHIAIGVYSFLALCVFILYVRCTAIDPADPGILIEPDRAIASPYRSHNGSQVPGNGSSVGEPSKMGFENVGIYDNGGGSGCCSKVAGFFCGCIVIEDCRKDEDMQQGGEEEALFCTLCNAEVRKYSKHCRSCDKCVDGFDHHCRWLNNCVGRKNYFTFVCLMAVSLVWLAFECGIGITVLVRCFADRKTTENQIAERLGDGFSRPPFATVVAICTAVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G109560`
TK1151 ID	TkA04G109560
OH-1004 ID	LXL04_035775
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 96.639 / OH-1004 53.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G109560

Location Chr04:28480123-28483393 (-)

Description Similar to PAT21: Protein S-acyltransferase 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33640`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release
`At4g15080`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g22180`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At1g69420`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At4g01730`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035775 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:1990918 double-strand break repair involved in meiotic recombination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17480

ath:AT2G33640

ath:AT2G33670

ath:AT3G22180

ath:AT4G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.365

Rank 1 · TkA04G109560 · TK1151

Lysosome / Vacuole0.217

Rank 2 · TkA04G109560 · TK1151

Endoplasmic reticulum0.195

Rank 3 · TkA04G109560 · TK1151

Cytoplasm0.180

Rank 4 · TkA04G109560 · TK1151

Golgi apparatus0.160

Rank 5 · TkA04G109560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529DHHC18-50 aa

PF01529DHHC152-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G109560	`PF01529`	DHHC	18	50	1.1e-34	120.0
TkA04G109560	`PF01529`	DHHC	152	288	1.1e-34	120.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DR03`	Arabidopsis thaliana	sp\|Q6DR03\|ZDHC3_ARATH Protein S-acyltransferase 21	59.000%	Swiss-Prot	High
`Q8L5Y5`	Arabidopsis thaliana	sp\|Q8L5Y5\|ZDH17_ARATH Probable protein S-acyltransferase 19	48.200%	Swiss-Prot	Medium
`Q9LIE4`	Arabidopsis thaliana	sp\|Q9LIE4\|ZDHC8_ARATH Probable protein S-acyltransferase 20	45.800%	Swiss-Prot	Medium
`Q9C533`	Arabidopsis thaliana	sp\|Q9C533\|ZDHC1_ARATH Probable protein S-acyltransferase 22	42.300%	Swiss-Prot	Medium
`Q9M115`	Arabidopsis thaliana	sp\|Q9M115\|ZDH16_ARATH Protein S-acyltransferase 18	30.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card