LXL04_035775 | RubberDandelionOmics

Gene overview

LXL04_035775

Reference: OH-1004 Chr: Chr08 Coordinates: 28582275-28589469 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3225 bp · LXL04_035775|LXL04_035775|OH1004|cDNA

ATGGAATCAAATGCACATGAAGCAGTTGTGGATCATACACATTTTTCAGAATCACGAACTGGATATAGAGTAGTCAGTAATTGGTGCTTTGTGCTTTATCCGGGTTCAGTTTCGGAGTTCCTATGGCGACATGGCTGGGAACTTCCTGCTCACACTTTTCAGGTTGTGGCTATTACAGTATTCTTCTTACTGTCGGTTGCCTTCTATGCATTCTTCTCACCTTTTCTCGGAAAGGACATCTACGAACATATAGCAATCGG...

CDS

Download CDS FASTA

3225 bp · LXL04_035775|LXL04_035775|OH1004|CDS

ATGGAATCAAATGCACATGAAGCAGTTGTGGATCATACACATTTTTCAGAATCACGAACTGGATATAGAGTAGTCAGTAATTGGTGCTTTGTGCTTTATCCGGGTTCAGTTTCGGAGTTCCTATGGCGACATGGCTGGGAACTTCCTGCTCACACTTTTCAGGTTGTGGCTATTACAGTATTCTTCTTACTGTCGGTTGCCTTCTATGCATTCTTCTCACCTTTTCTCGGAAAGGACATCTACGAACATATAGCAATCGG...

Protein

Download Protein FASTA

1074 aa · LXL04_035775|LXL04_035775|OH1004|PROTEIN

MESNAHEAVVDHTHFSESRTGYRVVSNWCFVLYPGSVSEFLWRHGWELPAHTFQVVAITVFFLLSVAFYAFFSPFLGKDIYEHIAIGVYSFLALCVFILYVRCTAIDPADPGILIEPDRAIASPYRSHNGSQVPGNGSSVGEPSKMGFENVGIYDNGGGSGCCSKVAGFFCGCIVIEDCRKDEDMQQGGEEEALFCTLCNAEVRKYSKHCRSCDKCVDGFDHHCRWLNNCVGRKNYFTFVCLMAVSLVWLAFECGIGITV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035775`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035775

Location Chr08:28582275-28589469 (+)

Description Similar to PAT21: Protein S-acyltransferase 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33640`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release
`At4g15080`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g22180`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17480`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035775 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:1990918 double-strand break repair involved in meiotic recombination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17480

ath:AT2G33640

ath:AT2G33670

ath:AT3G22180

ath:AT4G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.668

Rank 1 · LXL04_035775 · OH-1004

Endoplasmic reticulum0.152

Rank 2 · LXL04_035775 · OH-1004

Cytoplasm0.148

Rank 3 · LXL04_035775 · OH-1004

Lysosome / Vacuole0.102

Rank 4 · LXL04_035775 · OH-1004

Golgi apparatus0.090

Rank 5 · LXL04_035775 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529.26DHHC191-327 aa

PF03094.21Mlo631-668 aa

PF03094.21Mlo668-1037 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035775	`PF01529.26`	DHHC	191	327	2.9e-34	118.7
LXL04_035775	`PF03094.21`	Mlo	631	668	4.1e-159	530.7
LXL04_035775	`PF03094.21`	Mlo	668	1037	4.1e-159	530.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DR03`	Arabidopsis thaliana	Protein S-acyltransferase 21	55.109%	Swiss-Prot	moderate database homology
`Q8L5Y5`	Arabidopsis thaliana	Probable protein S-acyltransferase 19	46.307%	Swiss-Prot	moderate database homology
`Q9LIE4`	Arabidopsis thaliana	Probable protein S-acyltransferase 20	46.818%	Swiss-Prot	moderate database homology
`O22815`	Arabidopsis thaliana	MLO-like protein 5	48.441%	Swiss-Prot	weak database homology
`O22757`	Arabidopsis thaliana	MLO-like protein 8	47.799%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card