TkA04G109550 | RubberDandelionOmics

Gene overview

TkA04G109550

Reference: TK1151 Chr: Chr04 Coordinates: 28475853-28479439 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1987 bp · TkA04G109550|TK1151|cDNA

GTTAATTTGCCTCGCAAATTACATACATTATCATCCATCCTTAAACTCCATTTCTGTCGGGGACAGAAAAAACAAGATCAAACCTTTTCTCATTTTCTCAATTCACTTTTTCCTAACTTTCCAAATTCAACCAAAAAGAATTCTTGAAAGATCCGCTCTCATAATCTTGAAGCCATTTGATATCTTAATCTTGATGAATGAAAGAGAAAACGAACAATGACATACATATGATGGTCAATAAACAACTACAATTTTGATCA...

CDS

Download CDS FASTA

1482 bp · TkA04G109550|TK1151|CDS

ATGGGAGCAGGTAGGGGTCTAGATGAAACCGCAACATGGTCTGTGGCACTTGTTTGTGCCATCATCATTTGCATATCAATACTACTGGAAAAGGCGCTTCATCACATTGGACATCATCTGAAACATAAAAACAAAGTCGGGCTGCTCGAAGCGCTGGATAAGATCAAAACAGAGCTTATGGTGCTCGGATTTATATCTCTGTCTCTGACATTTTGTCAGAACAAAATTGCTTCTCTTTGTATTTCAAAGATATTTACGAA...

Protein

Download Protein FASTA

493 aa · TkA04G109550|TK1151|PROTEIN

MGAGRGLDETATWSVALVCAIIICISILLEKALHHIGHHLKHKNKVGLLEALDKIKTELMVLGFISLSLTFCQNKIASLCISKIFTKDFLPCKKQPDGKAPEDDEEDAEDARRRLLSYNPHRMLGGGEPVECKPGYEQLITVTGLHQLHVFIFFLAVFHVFYSALTMICGRTKIREWKHWEKDILQQQASGHDPSKFRLTKEISFVKGHATKTGVSVFFYIICFFRQFFTSVGRSDYMAMRHGFISVHLAPGTQFNFQKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G109550`
TK1151 ID	TkA04G109550
OH-1004 ID	LXL04_035775
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.800
Protein coverage (%)	TK1151 99.189 / OH-1004 41.341 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G109550

Location Chr04:28475853-28479439 (-)

Description Similar to PAT21: Protein S-acyltransferase 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g42560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17480`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At5g65970`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17430`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035775 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:1990918 double-strand break repair involved in meiotic recombination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17480

ath:AT2G33640

ath:AT2G33670

ath:AT3G22180

ath:AT4G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874

Rank 1 · TkA04G109550 · TK1151

Cytoplasm0.121

Rank 2 · TkA04G109550 · TK1151

Endoplasmic reticulum0.078

Rank 3 · TkA04G109550 · TK1151

Golgi apparatus0.041

Rank 4 · TkA04G109550 · TK1151

Nucleus0.033

Rank 5 · TkA04G109550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo5-456 aa

PF10745DUF253010-23 aa

PF20134DUF652413-27 aa

PF01848HOK_GEF16-29 aa

PF01848HOK_GEF221-236 aa

PF20134DUF6524253-291 aa

PF10745DUF2530268-307 aa

PF20134DUF6524292-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G109550	`PF03094`	Mlo	5	456	3.1e-188	626.8
TkA04G109550	`PF10745`	DUF2530	10	23	0.3	12.1
TkA04G109550	`PF20134`	DUF6524	13	27	2.9	8.4
TkA04G109550	`PF01848`	HOK_GEF	16	29	3.2	8.2
TkA04G109550	`PF01848`	HOK_GEF	221	236	3.2	8.2
TkA04G109550	`PF20134`	DUF6524	253	291	2.9	8.4
TkA04G109550	`PF10745`	DUF2530	268	307	0.3	12.1
TkA04G109550	`PF20134`	DUF6524	292	323	2.9	8.4
TkA04G109550	`PF20134`	DUF6524	394	411	2.9	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22815`	Arabidopsis thaliana	sp\|O22815\|MLO5_ARATH MLO-like protein 5	55.700%	Swiss-Prot	High
`Q94KB4`	Arabidopsis thaliana	sp\|Q94KB4\|MLO9_ARATH MLO-like protein 9	55.600%	Swiss-Prot	High
`O22757`	Arabidopsis thaliana	sp\|O22757\|MLO8_ARATH MLO-like protein 8	54.300%	Swiss-Prot	High
`Q9FKY5`	Arabidopsis thaliana	sp\|Q9FKY5\|MLO10_ARATH MLO-like protein 10	53.100%	Swiss-Prot	High
`O22752`	Arabidopsis thaliana	sp\|O22752\|MLO7_ARATH MLO-like protein 7	51.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card