RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G108980
Reference: TK1151 Chr: Chr04 Coordinates: 28328615-28331248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

906 bp · TkA04G108980|TK1151|cDNA

ATGGAAAAGTCTCCTGTTCCTACAAGTAGCATTGAAATTAACCTCAAGAAAGGTTCATGGACCACTGAAGAAGACCAACAGCTTATCCGTTATATCCAAAATCATGGCCATGGAAGCTGGAGATCTCTCCCTAAACTGGCCGGTCTTAAAAGATGTGGAAAGAGCTGCAGATTAAGATGGACGAATTATCTTCGACCAGATATAAAGAGAGGAAAATTCTCCCAAGAAGAAGAAAACATCATTCTTCACCTTCATTCCGT...

CDS

Download CDS FASTA

906 bp · TkA04G108980|TK1151|CDS

ATGGAAAAGTCTCCTGTTCCTACAAGTAGCATTGAAATTAACCTCAAGAAAGGTTCATGGACCACTGAAGAAGACCAACAGCTTATCCGTTATATCCAAAATCATGGCCATGGAAGCTGGAGATCTCTCCCTAAACTGGCCGGTCTTAAAAGATGTGGAAAGAGCTGCAGATTAAGATGGACGAATTATCTTCGACCAGATATAAAGAGAGGAAAATTCTCCCAAGAAGAAGAAAACATCATTCTTCACCTTCATTCCGT...

Protein

Download Protein FASTA

301 aa · TkA04G108980|TK1151|PROTEIN

MEKSPVPTSSIEINLKKGSWTTEEDQQLIRYIQNHGHGSWRSLPKLAGLKRCGKSCRLRWTNYLRPDIKRGKFSQEEENIILHLHSVLGNKWSTIATRLPGRTDNEIKNYWNTHMRKKLLQSGIDPMTHQPRTDLFSCLPQLLALANIKELLEQNQLAQNLQYFNQITSSVPQLQEENVSYVSEVPLEDQESEEIRQFFVGNSIFTQPLHQQVSITNLELTSNDYELVGHGHGQSRFTSVDSSSSISGITWDPIPPLIDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G108980
TK1151 IDTkA04G108980
OH-1004 IDLXL04_031167
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)56.300
Protein coverage (%)TK1151 99.668 / OH-1004 99.678
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G108980
LocationChr04:28328615-28331248 (+)
DescriptionSimilar to MYB93: Transcription factor MYB93
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g34670 Transcription factor that acts as a negative regulator of lateral root (LR) development.
AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.2014 · DOI: 10.1111/nph.12879
At5g10280 Probable transcription factor. No verified direct reference in this release
At5g65230 Probable transcription factor. No verified direct reference in this release
At4g21440 Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).
Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273
The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
At4g28110 Transcription factor involved in salt stress response.
AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874
Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137
AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009611 response to wounding Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010345 suberin biosynthetic process Biological Process
GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process
GO:0071365 cellular response to auxin stimulus Biological Process
GO:1901332 negative regulation of lateral root development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G34670
ath:AT4G05100
ath:AT4G21440
ath:AT5G10280
ath:AT5G65230
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.872
Rank 1 · TkA04G108980 · TK1151
Cytoplasm0.278
Rank 2 · TkA04G108980 · TK1151
Mitochondrion0.023
Rank 3 · TkA04G108980 · TK1151
Cell membrane0.018
Rank 4 · TkA04G108980 · TK1151
Lysosome / Vacuole0.011
Rank 5 · TkA04G108980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09111SLIDE11-43 aa
PF15963Myb_DNA-bind_716-36 aa
PF00249Myb_DNA-binding17-64 aa
PF23588HTH_CHD1_Hrp319-43 aa
PF13921Myb_DNA-bind_620-78 aa
PF08914Myb_Rap121-37 aa
PF30028YIL055C_C50-61 aa
PF08914Myb_Rap155-67 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G108980PF09111SLIDE11430.0514.4
TkA04G108980PF15963Myb_DNA-bind_716360.02515.1
TkA04G108980PF00249Myb_DNA-binding17646.6e-36122.9
TkA04G108980PF23588HTH_CHD1_Hrp319430.007217.0
TkA04G108980PF13921Myb_DNA-bind_620785.6e-2072.0
TkA04G108980PF08914Myb_Rap121370.2612.5
TkA04G108980PF30028YIL055C_C50610.08913.3
TkA04G108980PF08914Myb_Rap155670.2612.5
TkA04G108980PF09111SLIDE66910.0514.4
TkA04G108980PF00249Myb_DNA-binding701146.6e-36122.9
TkA04G108980PF15963Myb_DNA-bind_7721180.02515.1
TkA04G108980PF13921Myb_DNA-bind_6731185.6e-2072.0
TkA04G108980PF08914Myb_Rap173850.2612.5
TkA04G108980PF30028YIL055C_C1402520.08913.3
TkA04G108980PF13921Myb_DNA-bind_61581725.6e-2072.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S9Z2Arabidopsis thalianasp|Q9S9Z2|MYB93_ARATH Transcription factor MYB9369.100%Swiss-ProtMedium
Q9SBF3Arabidopsis thalianasp|Q9SBF3|MYB92_ARATH Transcription factor MYB9270.100%Swiss-ProtLow
Q9FJP2Arabidopsis thalianasp|Q9FJP2|MYB53_ARATH Transcription factor MYB5369.400%Swiss-ProtMedium
Q9LDR8Arabidopsis thalianasp|Q9LDR8|MY102_ARATH Transcription factor MYB10277.000%Swiss-ProtLow
Q9M0J5Arabidopsis thalianasp|Q9M0J5|MYB41_ARATH Transcription factor MYB4172.200%Swiss-ProtLow

JBrowse

View in Genome Browser