TkA04G104090 | RubberDandelionOmics

Gene overview

TkA04G104090

Reference: TK1151 Chr: Chr04 Coordinates: 27126537-27131858 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2331 bp · TkA04G104090|TK1151|cDNA

GCTGTGGGTATACCTTCATTAGGAATATACAATTAATTTCATCCATCCCAATCAGGATATTCAAGTTTATGGAAGGCTAACTTTGTAACCACATGTGTATATCTAGTCGTGGTCCTTTATTTACTAGTGAAATGAGCTAGAAACTAGAAACCTTCCAATTAATTAAGCTCCATATATACACACAGTTCACCCAAACACTTCAAAATAAAATATGTCTTCACCAACACTTCACGCACTTAATGTTGACATGTCTAATCTTC...

CDS

Download CDS FASTA

1977 bp · TkA04G104090|TK1151|CDS

ATGTCTTCACCAACACTTCACGCACTTAATGTTGACATGTCTAATCTTCCGGAAAAACAGAGCCCTGAACAGGAGTTTCACGTTACGAACCACACCGCCAAATGGGTTCTTAATTCACCAGATCCTCCAAGTTTTTGTCAACAGATTTCTGGCATCATAAAGAAGAACCTATTCCCTCAAAGAAACAGTAGGCCTTCGTCACTTTCTTCACACGTCATTGCGCTTTTGACTTGCATATTTCCTGTACTTGACTGGGGTAG...

Protein

Download Protein FASTA

658 aa · TkA04G104090|TK1151|PROTEIN

MSSPTLHALNVDMSNLPEKQSPEQEFHVTNHTAKWVLNSPDPPSFCQQISGIIKKNLFPQRNSRPSSLSSHVIALLTCIFPVLDWGRSYKASKFKNDLISGLTLASLSIPQSIGYAALANLDPQYGLYGSVVPPLIYSVMGTSQELAIGPVAVVSLLISSMVSKLVDPTLDPVAYRKLVFTATLFAGSFQALFGLLRLGFLIDFLSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTTKTDVVSVLDAVVKSLHTSWYPLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G104090`
TK1151 ID	TkA04G104090
OH-1004 ID	LXL04_035834
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.848 / OH-1004 99.697 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G104090

Location Chr04:27126537-27131858 (-)

Description Similar to ST3: Low affinity sulfate transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77990`	Low-affinity H(+)/sulfate cotransporter that may be involved in the distribution of sulfate from vascular bundles to the palisade cells of the leaves.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x
`At5g10180`	May act as a low-affinity H⁺/sulfate symporter in root-to-shoot sulfate transport.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x
`At1g22150`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate loading into sieve tubes.	Phloem-localizing sulfate transporter, Sultr1;3, mediates re-distribution of sulfur from source to sink organs in Arabidopsis.2003 · DOI: 10.1104/pp.014712
`At1g78000`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate uptake by plant roots.	Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x Selenate-resistant mutants of Arabidopsis thaliana identify Sultr1;2, a sulfate transporter required for efficient transport of sulfate into roots.2002 · DOI: 10.1046/j.0960-7412.2001.01232.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035834 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22150

ath:AT1G77990

ath:AT5G10180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.679

Rank 1 · TkA04G104090 · TK1151

Lysosome / Vacuole0.116

Rank 2 · TkA04G104090 · TK1151

Cytoplasm0.109

Rank 3 · TkA04G104090 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA04G104090 · TK1151

Mitochondrion0.048

Rank 5 · TkA04G104090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916Sulfate_transp94-474 aa

PF01740STAS527-644 aa

PF13466STAS_2578-628 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G104090	`PF00916`	Sulfate_transp	94	474	1.2e-135	452.9
TkA04G104090	`PF01740`	STAS	527	644	4.3e-21	75.4
TkA04G104090	`PF13466`	STAS_2	578	628	0.16	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92946`	Arabidopsis thaliana	sp\|P92946\|SUT22_ARATH Sulfate transporter 2.2	63.600%	Swiss-Prot	High
`O04722`	Arabidopsis thaliana	sp\|O04722\|SUT21_ARATH Sulfate transporter 2.1	63.200%	Swiss-Prot	High
`Q9FEP7`	Arabidopsis thaliana	sp\|Q9FEP7\|SUT13_ARATH Sulfate transporter 1.3	54.800%	Swiss-Prot	High
`Q9MAX3`	Arabidopsis thaliana	sp\|Q9MAX3\|SUT12_ARATH Sulfate transporter 1.2	52.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card