LXL04_035834 | RubberDandelionOmics

Gene overview

LXL04_035834

Reference: OH-1004 Chr: Chr08 Coordinates: 30108373-30112881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · LXL04_035834|LXL04_035834|OH1004|cDNA

ATGTCTTCACCAACACTTCACGCACTTAATGTTGACATGTCTAATCTTCCGGAAAAACAGAGCCCTGAACAGGAGTTTCACGTTACGAACCACACCGCCAAATGGGTTCTTAATTCACCAGATCCTCCAAGTTTTTGTCAACAGATTTCTGGCATCATAAAGAAGAACCTATTCCCTCAAAGAAACAGTAGGCCTTCGTCACTTTCTTCACACGTCATTGCGCTTTTGACTTGCATATTTCCTGTACTTGACTGGGGTAG...

CDS

Download CDS FASTA

1980 bp · LXL04_035834|LXL04_035834|OH1004|CDS

ATGTCTTCACCAACACTTCACGCACTTAATGTTGACATGTCTAATCTTCCGGAAAAACAGAGCCCTGAACAGGAGTTTCACGTTACGAACCACACCGCCAAATGGGTTCTTAATTCACCAGATCCTCCAAGTTTTTGTCAACAGATTTCTGGCATCATAAAGAAGAACCTATTCCCTCAAAGAAACAGTAGGCCTTCGTCACTTTCTTCACACGTCATTGCGCTTTTGACTTGCATATTTCCTGTACTTGACTGGGGTAG...

Protein

Download Protein FASTA

659 aa · LXL04_035834|LXL04_035834|OH1004|PROTEIN

MSSPTLHALNVDMSNLPEKQSPEQEFHVTNHTAKWVLNSPDPPSFCQQISGIIKKNLFPQRNSRPSSLSSHVIALLTCIFPVLDWGRGYKASKFKNDLISGLTLASLSIPQSIGYAALANLDPQYGLYGSVVPPLIYSVMGTSQELAIGPVAVVSLLISSMVSKLVDPTLDPVAYRKLVFTATLFAGSFQALFGLLRLGFLIDFLSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTTKTDVVSVLDAVVKSLHTSWYPLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035834`
TK1151 ID	TkA04G104090
OH-1004 ID	LXL04_035834
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.848 / OH-1004 99.697 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035834

Location Chr08:30108373-30112881 (+)

Description Similar to ST3: Low affinity sulfate transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77990`	Low-affinity H(+)/sulfate cotransporter that may be involved in the distribution of sulfate from vascular bundles to the palisade cells of the leaves.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x
`At5g10180`	May act as a low-affinity H⁺/sulfate symporter in root-to-shoot sulfate transport.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x
`At1g22150`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate loading into sieve tubes.	Phloem-localizing sulfate transporter, Sultr1;3, mediates re-distribution of sulfur from source to sink organs in Arabidopsis.2003 · DOI: 10.1104/pp.014712

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035834 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22150

ath:AT1G77990

ath:AT5G10180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.707

Rank 1 · LXL04_035834 · OH-1004

Cytoplasm0.113

Rank 2 · LXL04_035834 · OH-1004

Lysosome / Vacuole0.101

Rank 3 · LXL04_035834 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_035834 · OH-1004

Mitochondrion0.048

Rank 5 · LXL04_035834 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916.27Sulfate_transp94-474 aa

PF01740.27STAS527-644 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035834	`PF00916.27`	Sulfate_transp	94	474	1.2e-135	452.9
LXL04_035834	`PF01740.27`	STAS	527	644	4.4e-21	75.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92946`	Arabidopsis thaliana	Sulfate transporter 2.2	62.006%	Swiss-Prot	strong database homology
`O04722`	Arabidopsis thaliana	Sulfate transporter 2.1	60.671%	Swiss-Prot	strong database homology
`Q9FEP7`	Arabidopsis thaliana	Sulfate transporter 1.3	51.767%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card