TkA04G064350 | RubberDandelionOmics

Gene overview

TkA04G064350

Reference: TK1151 Chr: Chr04 Coordinates: 17139150-17139827 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA04G064350|TK1151|cDNA

ATGAAAATCTCCGCCAAACTCAACCCCAAACACATCTTCCGATCAAAGAAAAGCAGCTCGGTTTCCAGATCTGATCCATCTTCTTTCGGTTCCTACGCTACGACGTCCTCTGCCTCACCGGAGCCCAGCCATGGCCATCACAAGTCCATGTCGAGCGGTGTCGCTACTCCGACCAGCGTCCTACCTAGACACTCGTCCGAGAATTCCGCCGACGTACAGTTCGAGTTGGTGCAAGCGTTCAGGTTCATCGACAGCGACGG...

CDS

Download CDS FASTA

648 bp · TkA04G064350|TK1151|CDS

ATGAAAATCTCCGCCAAACTCAACCCCAAACACATCTTCCGATCAAAGAAAAGCAGCTCGGTTTCCAGATCTGATCCATCTTCTTTCGGTTCCTACGCTACGACGTCCTCTGCCTCACCGGAGCCCAGCCATGGCCATCACAAGTCCATGTCGAGCGGTGTCGCTACTCCGACCAGCGTCCTACCTAGACACTCGTCCGAGAATTCCGCCGACGTACAGTTCGAGTTGGTGCAAGCGTTCAGGTTCATCGACAGCGACGG...

Protein

Download Protein FASTA

215 aa · TkA04G064350|TK1151|PROTEIN

MKISAKLNPKHIFRSKKSSSVSRSDPSSFGSYATTSSASPEPSHGHHKSMSSGVATPTSVLPRHSSENSADVQFELVQAFRFIDSDGDGRITREELETILNRIGGSEPPIREELSLMLTELDRDGDGIITLEEFGAISSAFGPPACDTELRDAFDFFDTDHDGKITADELFGVFKSIADGRCTLEECRSMISSVDKNGDGFVCFEDFTRMMEQQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G064350`
TK1151 ID	TkA04G064350
OH-1004 ID	LXL04_036202
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G064350

Location Chr04:17139150-17139827 (+)

Description Similar to CML36: Probable calcium-binding protein CML36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41410`	Potential calcium sensor.	No verified direct reference in this release
`At3g10190`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0135700`	Potential calcium sensor.	No verified direct reference in this release
`Os05g0223000`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036202 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0050832 defense response to fungus Biological Process

GO:0005829 cytosol Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41410

ath:AT3G10190

dosa:Os01g0135700

dosa:Os01g0949500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · TkA04G064350 · TK1151

Nucleus0.318

Rank 2 · TkA04G064350 · TK1151

Cell membrane0.315

Rank 3 · TkA04G064350 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA04G064350 · TK1151

Golgi apparatus0.053

Rank 5 · TkA04G064350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591SPARC_Ca_bdg62-135 aa

PF23564EF-hand_FSTL163-100 aa

PF26745SPM69-99 aa

PF30624EF_SSP12073-134 aa

PF00036EF-hand_175-102 aa

PF13499EF-hand_775-134 aa

PF13405EF-hand_675-104 aa

PF12763EH75-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G064350	`PF10591`	SPARC_Ca_bdg	62	135	2.2e-05	25.4
TkA04G064350	`PF23564`	EF-hand_FSTL1	63	100	3.7e-05	24.8
TkA04G064350	`PF26745`	SPM	69	99	0.0048	17.8
TkA04G064350	`PF30624`	EF_SSP120	73	134	0.00058	21.2
TkA04G064350	`PF00036`	EF-hand_1	75	102	1.4e-28	97.0
TkA04G064350	`PF13499`	EF-hand_7	75	134	3.6e-27	95.2
TkA04G064350	`PF13405`	EF-hand_6	75	104	1.9e-25	86.8
TkA04G064350	`PF12763`	EH	75	96	1.1	9.9
TkA04G064350	`PF13202`	EF-hand_5	76	99	8.2e-25	85.8
TkA04G064350	`PF05042`	Caleosin	76	103	0.0013	19.4
TkA04G064350	`PF13833`	EF-hand_8	79	96	6.1e-18	65.0
TkA04G064350	`PF14658`	EF-hand_9	79	137	3.4e-06	28.1
TkA04G064350	`PF21008`	AIF-1	79	134	0.038	15.0
TkA04G064350	`PF28844`	BamM_C	80	100	0.044	14.5
TkA04G064350	`PF29176`	Allatotropin-like_C	81	96	4.6e-09	36.4
TkA04G064350	`PF26745`	SPM	83	130	0.0048	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P30188`	Arabidopsis thaliana	sp\|P30188\|CML35_ARATH Probable calcium-binding protein CML35	47.500%	Swiss-Prot	Medium
`Q9SS31`	Arabidopsis thaliana	sp\|Q9SS31\|CML36_ARATH Probable calcium-binding protein CML36	48.800%	Swiss-Prot	Medium
`Q5ZCK5`	Oryza sativa subsp. japonica	sp\|Q5ZCK5\|CML16_ORYSJ Probable calcium-binding protein CML16	39.100%	Swiss-Prot	Medium
`Q0DJV6`	Oryza sativa subsp. japonica	sp\|Q0DJV6\|CML18_ORYSJ Probable calcium-binding protein CML18	34.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card