LXL04_036202 | RubberDandelionOmics

Gene overview

LXL04_036202

Reference: OH-1004 Chr: Chr08 Coordinates: 37851998-37852675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · LXL04_036202|LXL04_036202|OH1004|cDNA

ATGAAAATCTCCGCCAAACTCAACCCCAAACACATCTTCCGATCAAAGAAAAGCAGCTCGGTTTCCAGATCTGATCCATCTTCTTTCGGTTCCTACGCTACGACGTCCTCTGCCTCACCGGAGCCCAGCCATGGCCATCACAAGTCCATGTCGAGCGGTGTCGCTACTCCGACCAGCGTCCTACCTAGACACTCGAACGCCAACGAAATATCTTCCGATGAGTGGTCCGAGAATTCCGCCGACGTACAGTTCGAGTTGGT...

CDS

Download CDS FASTA

678 bp · LXL04_036202|LXL04_036202|OH1004|CDS

ATGAAAATCTCCGCCAAACTCAACCCCAAACACATCTTCCGATCAAAGAAAAGCAGCTCGGTTTCCAGATCTGATCCATCTTCTTTCGGTTCCTACGCTACGACGTCCTCTGCCTCACCGGAGCCCAGCCATGGCCATCACAAGTCCATGTCGAGCGGTGTCGCTACTCCGACCAGCGTCCTACCTAGACACTCGAACGCCAACGAAATATCTTCCGATGAGTGGTCCGAGAATTCCGCCGACGTACAGTTCGAGTTGGT...

Protein

Download Protein FASTA

225 aa · LXL04_036202|LXL04_036202|OH1004|PROTEIN

MKISAKLNPKHIFRSKKSSSVSRSDPSSFGSYATTSSASPEPSHGHHKSMSSGVATPTSVLPRHSNANEISSDEWSENSADVQFELVQAFRFIDSDGDGRITREELETILNRIGGSEPPIREELSLMLTELDRDGDGIITLEEFGAISSAFGPPACDTELRDAFDFFDTDHDGKITADELFGVFKSIADGRCTLEECRSMISSVDKNGDGFVCFEDFTRMMEQQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036202`
TK1151 ID	TkA04G064350
OH-1004 ID	LXL04_036202
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036202

Location Chr08:37851998-37852675 (-)

Description Similar to CML36: Probable calcium-binding protein CML36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10190`	Potential calcium sensor.	No verified direct reference in this release
`At2g41410`	Potential calcium sensor.	No verified direct reference in this release
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0949500`	Potential calcium sensor.	No verified direct reference in this release
`Os01g0135700`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036202 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0050832 defense response to fungus Biological Process

GO:0005829 cytosol Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41410

ath:AT3G10190

dosa:Os01g0135700

dosa:Os01g0949500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.456

Rank 1 · LXL04_036202 · OH-1004

Nucleus0.318

Rank 2 · LXL04_036202 · OH-1004

Cell membrane0.308

Rank 3 · LXL04_036202 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_036202 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_036202 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_185-112 aa

PF13499.13EF-hand_785-144 aa

PF13405.13EF-hand_685-114 aa

PF13202.13EF-hand_586-109 aa

PF13833.13EF-hand_899-144 aa

PF00036.39EF-hand_1125-147 aa

PF13499.13EF-hand_7158-221 aa

PF13833.13EF-hand_8158-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036202	`PF00036.39`	EF-hand_1	85	112	6.8e-29	98.0
LXL04_036202	`PF13499.13`	EF-hand_7	85	144	4.2e-27	95.0
LXL04_036202	`PF13405.13`	EF-hand_6	85	114	2.1e-25	86.7
LXL04_036202	`PF13202.13`	EF-hand_5	86	109	9.8e-24	82.4
LXL04_036202	`PF13833.13`	EF-hand_8	99	144	7.1e-18	64.8
LXL04_036202	`PF00036.39`	EF-hand_1	125	147	6.8e-29	98.0
LXL04_036202	`PF13499.13`	EF-hand_7	158	221	4.2e-27	95.0
LXL04_036202	`PF13833.13`	EF-hand_8	158	185	7.1e-18	64.8
LXL04_036202	`PF00036.39`	EF-hand_1	159	186	6.8e-29	98.0
LXL04_036202	`PF13405.13`	EF-hand_6	159	186	2.1e-25	86.7
LXL04_036202	`PF13202.13`	EF-hand_5	160	180	9.8e-24	82.4
LXL04_036202	`PF00036.39`	EF-hand_1	196	222	6.8e-29	98.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS31`	Arabidopsis thaliana	Probable calcium-binding protein CML36	44.690%	Swiss-Prot	moderate database homology
`P30188`	Arabidopsis thaliana	Probable calcium-binding protein CML35	46.903%	Swiss-Prot	moderate database homology
`Q9FYK2`	Arabidopsis thaliana	Probable calcium-binding protein CML25	43.165%	Swiss-Prot	moderate database homology
`Q8RZB5`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML10	42.446%	Swiss-Prot	moderate database homology
`Q5ZCK5`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML16	45.270%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card