TkA04G058580 | RubberDandelionOmics

Gene overview

TkA04G058580

Reference: TK1151 Chr: Chr04 Coordinates: 15614621-15617155 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1709 bp · TkA04G058580|TK1151|cDNA

TACACTTATAATATTTGCTTCATAAATCTAAAAAAAAGTCGTGTAATTAATTGGGTTTTCATAGTTGTCGTTCATCCCGCTCGATGCTAGGGTTTCGATGGCTTATCCTCACTGTGATTCCATCAGCAGTTCGTCCCTACACAAACACGCTCTCTCATATACTCAGAGCCCTAATATATCGGAACCTCCGGCGATTAATGGTTACGACTTAGATGAAAACTTGCTAGTTCTTAATCCATCAATTCCCTGTTTCTCCCCAT...

CDS

Download CDS FASTA

714 bp · TkA04G058580|TK1151|CDS

ATGCTAACACGTGCAACTGAAGCTGTTGCAACTAAATTTAGAAACCCTAAAACAACATGTGTGCTAGAAACAGTCAACGGATCCATGACTGAATCACCACAACCTGTAATTATCAAGAACAGTGATTTGGAAAACTCTAATGCGAATCCTCTATTGTGCTCACACTTTTGTTATGAAGATTGGAAACACAAATCTCCTTCAGTAGAGAATGCAGATAAAATCCAAGTAAGCTTCTTTTTATCTACATCAGTACCCTCTGT...

Protein

Download Protein FASTA

237 aa · TkA04G058580|TK1151|PROTEIN

MLTRATEAVATKFRNPKTTCVLETVNGSMTESPQPVIIKNSDLENSNANPLLCSHFCYEDWKHKSPSVENADKIQVSFFLSTSVPSVKPTAPFAENIPGESKHLVVHYKLKVICYATKDLLLKDAILNLIIPGLIDQLHTMKNMTLPNLLSQHPKLHPYHFSPPGFLHPITAIYDLIYGETEMKQVEIRRALHMRLGLPLDRPLLRIASPIDFLTSKEGARGNNLRKYLQISIFVQA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G058580`
TK1151 ID	TkA04G058580
OH-1004 ID	LXL04_036275
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.249 / OH-1004 60.218 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G058580

Location Chr04:15614621-15617155 (-)

Description Similar to At3g48380: Probable Ufm1-specific protease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48380`	Thiol protease which recognizes and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, a ubiquitin-like modifier protein bound to a number of target proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0285500`	Thiol protease which recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ufm-1, a ubiquitin-like modifier protein bound to a number of target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036275 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0071567 deUFMylase activity Molecular Function

KEGG gene cross-reference

ath:AT1G52360

ath:AT3G15980

ath:AT3G48380

dosa:Os06g0143900

dosa:Os12g0285500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.344

Rank 1 · TkA04G058580 · TK1151

Nucleus0.311

Rank 2 · TkA04G058580 · TK1151

Cytoplasm0.309

Rank 3 · TkA04G058580 · TK1151

Cell membrane0.059

Rank 4 · TkA04G058580 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA04G058580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20908UfSP2_N62-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G058580	`PF20908`	UfSP2_N	62	210	6.5e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STL8`	Arabidopsis thaliana	sp\|Q9STL8\|UFSP_ARATH Probable Ufm1-specific protease	43.500%	Swiss-Prot	Medium
`Q0INW1`	Oryza sativa subsp. japonica	sp\|Q0INW1\|UFSP_ORYSJ Probable Ufm1-specific protease	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card