RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G058510
Reference: TK1151 Chr: Chr04 Coordinates: 15596858-15597412 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

555 bp · TkA04G058510|TK1151|cDNA

ATGGTGGACATATTAGGAAGAGCTAATAAATTAAACGAAGCATTACAAATTATCCAAGAAATGCCAATAAAACCCACGGAATCCATATGGGGTGCATTTTTAACAGGATGTAGACTTCATAATCATACAAATCTAGCGGAATATGCTGCTGACAAAATGTCTGAATTAGGTCCCGTGAGTTCAGGCATGCATGTGTTATTATCCAACACGTATGCATCTGTTGGGAGATATGAAGAGGCGGGTAAAGTGCGTAAAATGTT...

CDS

Download CDS FASTA

555 bp · TkA04G058510|TK1151|CDS

ATGGTGGACATATTAGGAAGAGCTAATAAATTAAACGAAGCATTACAAATTATCCAAGAAATGCCAATAAAACCCACGGAATCCATATGGGGTGCATTTTTAACAGGATGTAGACTTCATAATCATACAAATCTAGCGGAATATGCTGCTGACAAAATGTCTGAATTAGGTCCCGTGAGTTCAGGCATGCATGTGTTATTATCCAACACGTATGCATCTGTTGGGAGATATGAAGAGGCGGGTAAAGTGCGTAAAATGTT...

Protein

Download Protein FASTA

184 aa · TkA04G058510|TK1151|PROTEIN

MVDILGRANKLNEALQIIQEMPIKPTESIWGAFLTGCRLHNHTNLAEYAADKMSELGPVSSGMHVLLSNTYASVGRYEEAGKVRKMLRDIGVKKETGLSWVEEGNLVHTFSSGDRRHFMSDEIYEKLEELESEIVKAGYVVDTSYVLRGVGGEEKSMAIRYHSERLAVAFGLIVFKDRKGRLGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G058510
TK1151 IDTkA04G058510
OH-1004 IDLXL04_036278
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 97.283 / OH-1004 24.387
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G058510
LocationChr04:15596858-15597412 (+)
DescriptionSimilar to PCMP-H52: Putative pentatricopeptide repeat-containing protein At5g52630
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g52630 Putative pentatricopeptide repeat-containing protein At5g52630. No verified direct reference in this release
At4g02750 Pentatricopeptide repeat-containing protein At4g02750. No verified direct reference in this release
At3g24000 Pentatricopeptide repeat-containing protein At3g24000, mitochondrial. No verified direct reference in this release
At2g27610 Pentatricopeptide repeat-containing protein At2g27610. No verified direct reference in this release
At2g22070 Pentatricopeptide repeat-containing protein At2g22070. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036278 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009451 RNA modification Biological Process
GO:0010214 seed coat development Biological Process
GO:0016554 cytidine to uridine editing Biological Process
GO:0140547 acquisition of seed longevity Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT3G24000
ath:AT4G02750
ath:AT5G52630
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.431
Rank 1 · TkA04G058510 · TK1151
Plastid0.244
Rank 2 · TkA04G058510 · TK1151
Nucleus0.126
Rank 3 · TkA04G058510 · TK1151
Cytoplasm0.108
Rank 4 · TkA04G058510 · TK1151
Peroxisome0.026
Rank 5 · TkA04G058510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR1-21 aa
PF01535PPR29-56 aa
PF20431E_motif40-102 aa
PF01535PPR70-92 aa
PF20430Eplus_motif107-133 aa
PF01535PPR121-129 aa
PF20431E_motif125-133 aa
PF14432DYW_deaminase138-177 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G058510PF01535PPR1210.0006920.4
TkA04G058510PF01535PPR29560.0006920.4
TkA04G058510PF20431E_motif401027.8e-1452.4
TkA04G058510PF01535PPR70920.0006920.4
TkA04G058510PF20430Eplus_motif1071333.9e-0730.4
TkA04G058510PF01535PPR1211290.0006920.4
TkA04G058510PF20431E_motif1251337.8e-1452.4
TkA04G058510PF14432DYW_deaminase1381779.5e-0626.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LTF4Arabidopsis thalianasp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containing protein At5g5263067.400%Swiss-ProtHigh
Q9SY02Arabidopsis thalianasp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g0275053.200%Swiss-ProtHigh
Q9LIQ7Arabidopsis thalianasp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial47.900%Swiss-ProtMedium
Q9ZUW3Arabidopsis thalianasp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g2761045.100%Swiss-ProtMedium
Q9SHZ8Arabidopsis thalianasp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g2207043.800%Swiss-ProtMedium

JBrowse

View in Genome Browser