RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_036278
Reference: OH-1004 Chr: Chr08 Coordinates: 39206522-39212320 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2205 bp · LXL04_036278|LXL04_036278|OH1004|cDNA

ATGGCTAGTAAAAGTGGCAAAATAGAATGGTCCGTGCAAATTGCAAACAAAGGAATTAATCAATGCACGGACCCTGTTCAAGAGCGTCTTGTGGTTGGAGGAGAGGAGCGCGGCAATTTCGTACCTGAAGAAGAAGGCGAGAACGAAGGTAAACGCAGGCGAAAGGTTTCAAACTGTTTTCTAAACCGGTTCGAAGCTGGTATTAAAAGGGGCAATGGGCCAGAACTTTTCATGAAGTCTAGAGCCCATTTGTTGGCGAT...

CDS

Download CDS FASTA

2205 bp · LXL04_036278|LXL04_036278|OH1004|CDS

ATGGCTAGTAAAAGTGGCAAAATAGAATGGTCCGTGCAAATTGCAAACAAAGGAATTAATCAATGCACGGACCCTGTTCAAGAGCGTCTTGTGGTTGGAGGAGAGGAGCGCGGCAATTTCGTACCTGAAGAAGAAGGCGAGAACGAAGGTAAACGCAGGCGAAAGGTTTCAAACTGTTTTCTAAACCGGTTCGAAGCTGGTATTAAAAGGGGCAATGGGCCAGAACTTTTCATGAAGTCTAGAGCCCATTTGTTGGCGAT...

Protein

Download Protein FASTA

734 aa · LXL04_036278|LXL04_036278|OH1004|PROTEIN

MASKSGKIEWSVQIANKGINQCTDPVQERLVVGGEERGNFVPEEEGENEGKRRRKVSNCFLNRFEAGIKRGNGPELFMKSRAHLLAMFFSNKQHIGTKRVWKSGLLPIYHRNAFFTFQRHYSGRLPARHRIRLLLWTLAITSNRHYGDWDLYFFISIRLMLPAVTTCSYLPVLYPGICCDENVIFDSRASTCSYSNLHQQQKLFLQTPLLPIESQRIFDETHLKSSTTWSSIISSFAQNDLPILALQYFKKMIDYGIRPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_036278
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_036278
LocationChr08:39206522-39212320 (-)
DescriptionSimilar to PCMP-H52: Putative pentatricopeptide repeat-containing protein At5g52630
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g52630 Putative pentatricopeptide repeat-containing protein At5g52630. No verified direct reference in this release
At3g24000 Pentatricopeptide repeat-containing protein At3g24000, mitochondrial. No verified direct reference in this release
At4g02750 Pentatricopeptide repeat-containing protein At4g02750. No verified direct reference in this release
At5g04780 Pentatricopeptide repeat-containing protein At5g04780, mitochondrial. No verified direct reference in this release
At4g14850 Acts as a regulatory factor of isoprenoid biosynthesis.
Lovastatin insensitive 1, a Novel pentatricopeptide repeat protein, is a potential regulatory factor of isoprenoid biosynthesis in Arabidopsis.2007 · DOI: 10.1093/pcp/pcm005

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036278 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009451 RNA modification Biological Process
GO:0010214 seed coat development Biological Process
GO:0016554 cytidine to uridine editing Biological Process
GO:0140547 acquisition of seed longevity Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT3G24000
ath:AT4G02750
ath:AT5G52630
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.535
Rank 1 · LXL04_036278 · OH-1004
Plastid0.298
Rank 2 · LXL04_036278 · OH-1004
Nucleus0.082
Rank 3 · LXL04_036278 · OH-1004
Cytoplasm0.043
Rank 4 · LXL04_036278 · OH-1004
Cell membrane0.009
Rank 5 · LXL04_036278 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535.27PPR228-257 aa
PF13041.13PPR_2325-373 aa
PF17177.11PPR_long339-533 aa
PF13041.13PPR_2427-474 aa
PF29070.1MSC6_N434-522 aa
PF20431.5E_motif543-605 aa
PF20430.4Eplus_motif610-635 aa
PF14432.13DYW_deaminase641-734 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_036278PF01535.27PPR2282571.6e-35119.6
LXL04_036278PF13041.13PPR_23253731.1e-31109.4
LXL04_036278PF17177.11PPR_long3395336.1e-0833.0
LXL04_036278PF13041.13PPR_24274741.1e-31109.4
LXL04_036278PF29070.1MSC6_N4345222.3e-0834.3
LXL04_036278PF20431.5E_motif5436052.7e-1350.7
LXL04_036278PF20430.4Eplus_motif6106352.7e-0627.7
LXL04_036278PF14432.13DYW_deaminase6417348.1e-34116.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LTF4Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At5g5263065.725%Swiss-Protstrong database homology
Q9LIQ7Arabidopsis thalianaPentatricopeptide repeat-containing protein At3g24000, mitochondrial41.379%Swiss-Protmoderate database homology
Q9SY02Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g0275041.935%Swiss-Protmoderate database homology
Q9LZ19Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g04780, mitochondrial42.146%Swiss-Protmoderate database homology
Q0WSH6Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g1485040.000%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser