TkA04G056460 | RubberDandelionOmics

Gene overview

TkA04G056460

Reference: TK1151 Chr: Chr04 Coordinates: 15055427-15068324 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2149 bp · TkA04G056460|TK1151|cDNA

CTCTCCTCTCTTTCTTCAGGTCGTTGCTGGTTTTTGCCGATTGAAATATTTTTAGAGAGAGAGACACCAGAGAAGGATTTTTGGTTCCAGATAGCAACTTAATGTTCTAATAACAGCAGGAGAGAGAGAGAGATGGAAGAGTGATAAAATAGCTTAAAAGTTTGTCTTTTTCATCTTTAGCATTCAATTCATGCTCTGAATTTCTTTCAACACCCCCACCACCTCCCCTTTAGAGAGACTTATCTCTACATGTATAGATG...

CDS

Download CDS FASTA

1656 bp · TkA04G056460|TK1151|CDS

ATGAGTTTTGAGAGAGGTGAAGAAGACCTTCTTAGTCATCATCATCATCAAAACCACCCATCACCGCCACCTGATCATCATCACCACCACCGCCAAGAAAACACCAAAAACAAAAATCCTCCCTTTTTCGCAAATATCATGGCTACAACAAACAAAGGCTATTCGAATACGTCAACCAACGCTTTCCTAGACCCACAACATCATCATCATCATCACCAACTACAGTTTTCCCAGCATCAAGAACATCATCACCATGACAC...

Protein

Download Protein FASTA

551 aa · TkA04G056460|TK1151|PROTEIN

MSFERGEEDLLSHHHHQNHPSPPPDHHHHHRQENTKNKNPPFFANIMATTNKGYSNTSTNAFLDPQHHHHHHQLQFSQHQEHHHHDTNQISFAMVNHNSMPSSSIRPPSNPSTTDENIMRNDGGGPYDLADLDQALFLYGEGQPAGSGDPSALSTIQDHQRQGSASSGMRPPTLNIFPSQPMHVVDPSTSATKANAGLVSPSSSGSRRPSDQSMENIATHKKDAPPPAPQSSKAIKNEGNRKGPSTSSDQNRPKTPDPKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G056460`
TK1151 ID	TkA04G056460
OH-1004 ID	LXL04_014748
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.200
Protein coverage (%)	TK1151 53.902 / OH-1004 88.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G056460

Location Chr04:15055427-15068324 (+)

Description Similar to Transcription factor HBP-1b(c1) (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06839`	Together with TGA9, basic leucine-zipper transcription factor required for anther development, probably via the activation of SPL expression in anthers and via the regulation of genes with functions in early and middle tapetal development.	Arabidopsis basic leucine-zipper transcription factors TGA9 and TGA10 interact with floral glutaredoxins ROXY1 and ROXY2 and are redundantly required for anther development.2010 · DOI: 10.1104/pp.110.159111 Arabidopsis clade IV TGA transcription factors, TGA10 and TGA9, are involved in ROS-mediated responses to bacterial PAMP flg22.2016 · DOI: 10.1016/j.plantsci.2016.06.019

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0280500`	Transcriptional regulator involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12250

dosa:Os01g0279900

osa:4326907

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.850

Rank 1 · TkA04G056460 · TK1151

Cytoplasm0.210

Rank 2 · TkA04G056460 · TK1151

Cell membrane0.048

Rank 3 · TkA04G056460 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA04G056460 · TK1151

Plastid0.015

Rank 5 · TkA04G056460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716bZIP_2256-301 aa

PF00170bZIP_1259-299 aa

PF28673bZIP_CREBRF_C262-301 aa

PF14144DOG1350-424 aa

PF28673bZIP_CREBRF_C441-469 aa

PF00170bZIP_1444-468 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G056460	`PF07716`	bZIP_2	256	301	1.7e-07	31.9
TkA04G056460	`PF00170`	bZIP_1	259	299	6.5e-08	33.3
TkA04G056460	`PF28673`	bZIP_CREBRF_C	262	301	0.076	14.1
TkA04G056460	`PF14144`	DOG1	350	424	2e-29	102.3
TkA04G056460	`PF28673`	bZIP_CREBRF_C	441	469	0.076	14.1
TkA04G056460	`PF00170`	bZIP_1	444	468	6.5e-08	33.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`E3VNM4`	Arabidopsis thaliana	sp\|E3VNM4\|TGA10_ARATH Transcription factor TGA10	61.100%	Swiss-Prot	High
`Q6H434`	Oryza sativa subsp. japonica	sp\|Q6H434\|TGAL7_ORYSJ Transcription factor TGAL7	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card