TkA04G048270 | RubberDandelionOmics

Gene overview

TkA04G048270

Reference: TK1151 Chr: Chr04 Coordinates: 12945974-12948424 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1182 bp · TkA04G048270|TK1151|cDNA

GTCGAATCATCACTTTTAAAGGTAGCACAACACCATGTCGGACTCTGTCCTTCTTGTCATTTCTCTTCTTCTGGTGATCGGAAACTTCCATGATACAAGATTCTTCGTATATGGTGTAGTTGATGAATATAAAAGAGATGATTTTCCAGATGATTTCGTTTTCGGTTCAGGAACTTCAGCTTATCAGGTTGAAGGAGCGGTATTGGAAGATGGAAGGAGTTTTAGCATCTGGGATACATTCGCTCATAATCCAGGGGTTA...

CDS

Download CDS FASTA

897 bp · TkA04G048270|TK1151|CDS

ATGTCGGACTCTGTCCTTCTTGTCATTTCTCTTCTTCTGGTGATCGGAAACTTCCATGATACAAGATTCTTCGTATATGGTGTAGTTGATGAATATAAAAGAGATGATTTTCCAGATGATTTCGTTTTCGGTTCAGGAACTTCAGCTTATCAGGTTGAAGGAGCGGTATTGGAAGATGGAAGGAGTTTTAGCATCTGGGATACATTCGCTCATAATCCAGGGGTTACGTGGTACAATGGAGCAAATGCAGACATAACATG...

Protein

Download Protein FASTA

298 aa · TkA04G048270|TK1151|PROTEIN

MSDSVLLVISLLLVIGNFHDTRFFVYGVVDEYKRDDFPDDFVFGSGTSAYQVEGAVLEDGRSFSIWDTFAHNPGVTWYNGANADITCDGYHKYKEDIQLWWRQVLEAYRFSISWSRLIPNGRGSVNVKGLQYYNDFINILIAHGIQPHVTLHHFDLPQVLEDEYGGWISRKSVKDFVAYADVCFREFGDRVLHWTTFNEANIFSLSGYDFAFSPPGRCSSPFGMINCSRGDSTSEPYLVTHYLLLAHASAVKLYRQKYKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G048270`
TK1151 ID	TkA04G048270
OH-1004 ID	LXL04_036419
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.600
Protein coverage (%)	TK1151 97.987 / OH-1004 72.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G048270

Location Chr04:12945974-12948424 (-)

Description Similar to HIUH: Hydroxyisourate hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02850`	Beta-glucosidase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0365600`	Beta-glucosidase 19.	No verified direct reference in this release
`Os09g0511600`	Beta-glucosidase 31.	No verified direct reference in this release
`Os09g0511700`	Beta-glucosidase 32.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036419 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006144 purine nucleobase metabolic process Biological Process

GO:0019628 urate catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0033971 hydroxyisourate hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02850

dosa:Os01g0813800

dosa:Os05g0365600

gmx:547954

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.414

Rank 1 · TkA04G048270 · TK1151

Lysosome / Vacuole0.249

Rank 2 · TkA04G048270 · TK1151

Cytoplasm0.101

Rank 3 · TkA04G048270 · TK1151

Extracellular0.084

Rank 4 · TkA04G048270 · TK1151

Cell membrane0.047

Rank 5 · TkA04G048270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_134-298 aa

PF04646DUF604133-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G048270	`PF00232`	Glyco_hydro_1	34	298	3.4e-87	293.6
TkA04G048270	`PF04646`	DUF604	133	158	0.27	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H5Q1`	Arabidopsis thaliana	sp\|B3H5Q1\|BGL11_ARATH Beta-glucosidase 11	58.400%	Swiss-Prot	High
`Q0DIT2`	Oryza sativa subsp. japonica	sp\|Q0DIT2\|BGL19_ORYSJ Beta-glucosidase 19	61.300%	Swiss-Prot	High
`B7F7K7`	Oryza sativa subsp. japonica	sp\|B7F7K7\|BGL31_ORYSJ Beta-glucosidase 31	60.800%	Swiss-Prot	High
`Q0J0G2`	Oryza sativa subsp. japonica	sp\|Q0J0G2\|BGL32_ORYSJ Beta-glucosidase 32	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card