LXL04_036419 | RubberDandelionOmics

Gene overview

LXL04_036419

Reference: OH-1004 Chr: Chr08 Coordinates: 41674894-41677546 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_036419|LXL04_036419|OH1004|cDNA

ATGTCGGACTCTGTCCTTCTTGTCATTTCTCTTCTTCTGGTGATCGGAAACTTCCATGATACAAGATTCTTCGTATATGGTGTAGTTGATGAATATAAAAGAGATGATTTTCCAGATGATTTCGTTTTCGGTTCAGGAACTTCAGCTTATCAGGTTGAAGGAGCGGTATTGGAAGATGGAAGGAGTTTTAGCATCTGGGATACATTCGCTCATAATCCAGGGGTTACGTGGTACAATGGAGCAAATGCAGACATAACATG...

CDS

Download CDS FASTA

1218 bp · LXL04_036419|LXL04_036419|OH1004|CDS

ATGTCGGACTCTGTCCTTCTTGTCATTTCTCTTCTTCTGGTGATCGGAAACTTCCATGATACAAGATTCTTCGTATATGGTGTAGTTGATGAATATAAAAGAGATGATTTTCCAGATGATTTCGTTTTCGGTTCAGGAACTTCAGCTTATCAGGTTGAAGGAGCGGTATTGGAAGATGGAAGGAGTTTTAGCATCTGGGATACATTCGCTCATAATCCAGGGGTTACGTGGTACAATGGAGCAAATGCAGACATAACATG...

Protein

Download Protein FASTA

405 aa · LXL04_036419|LXL04_036419|OH1004|PROTEIN

MSDSVLLVISLLLVIGNFHDTRFFVYGVVDEYKRDDFPDDFVFGSGTSAYQVEGAVLEDGRSFSIWDTFAHNPGVTWYNGANADITCDGYHKYKKDIQLMVETGLEAYRFSISWSRLIPNGRGSVNVKGLQYYNDFINILIAHGIQPHVTLHHFDLPQVLEDEYGGWISRKSVKDFVAYADVCFREFGDRVLHWTTFNEANIFSLSGYDFAFSPPGRCSSPFGMINCSRGDSTSEPYLVTHYLLLAHASAVKLYRQKYKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036419`
TK1151 ID	TkA04G048270
OH-1004 ID	LXL04_036419
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.600
Protein coverage (%)	TK1151 97.987 / OH-1004 72.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036419

Location Chr08:41674894-41677546 (+)

Description Similar to HIUH: Hydroxyisourate hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02850`	Beta-glucosidase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0365600`	Beta-glucosidase 19.	No verified direct reference in this release
`Os01g0813700`	Beta-glucosidase 2.	No verified direct reference in this release
`Os01g0813800`	Beta-glucosidase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036419 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006144 purine nucleobase metabolic process Biological Process

GO:0019628 urate catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0033971 hydroxyisourate hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02850

dosa:Os01g0813800

dosa:Os05g0365600

gmx:547954

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.386

Rank 1 · LXL04_036419 · OH-1004

Lysosome / Vacuole0.218

Rank 2 · LXL04_036419 · OH-1004

Cytoplasm0.152

Rank 3 · LXL04_036419 · OH-1004

Extracellular0.091

Rank 4 · LXL04_036419 · OH-1004

Cell membrane0.074

Rank 5 · LXL04_036419 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232.25Glyco_hydro_134-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036419	`PF00232.25`	Glyco_hydro_1	34	292	1.1e-87	295.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H5Q1`	Arabidopsis thaliana	Beta-glucosidase 11	57.840%	Swiss-Prot	moderate database homology
`Q0DIT2`	Oryza sativa subsp. japonica	Beta-glucosidase 19	62.357%	Swiss-Prot	moderate database homology
`B7F8N7`	Oryza sativa subsp. japonica	Beta-glucosidase 2	62.162%	Swiss-Prot	moderate database homology
`Q8RZL1`	Oryza sativa subsp. japonica	Beta-glucosidase 3	59.245%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card