TkA04G038490 | RubberDandelionOmics

Gene overview

TkA04G038490

Reference: TK1151 Chr: Chr04 Coordinates: 10316893-10326390 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1397 bp · TkA04G038490|TK1151|cDNA

AGGTTTTTGCAAAAACTACCAAGACGAAAATGGAGATTTTAAGGAATCCTTATCCAATGATGTTGAAGGCATGCTTGAGTTGTATGAAGCCACGTACCTAAGGGTTGAAGGTGAAGTTATTCTAGATGATGCTCTTGTTTTTACAAGATCCCGTCTTAACGACATATCAAAGGATACTCTTTTCGGCAACTCTACCTTATCTATCAAGATACAGGCGGCACTAAAGCAACCCATACGAAAAAGGATGCCAAGACTAGAGG...

CDS

Download CDS FASTA

1209 bp · TkA04G038490|TK1151|CDS

ATGCTTGAGTTGTATGAAGCCACGTACCTAAGGGTTGAAGGTGAAGTTATTCTAGATGATGCTCTTGTTTTTACAAGATCCCGTCTTAACGACATATCAAAGGATACTCTTTTCGGCAACTCTACCTTATCTATCAAGATACAGGCGGCACTAAAGCAACCCATACGAAAAAGGATGCCAAGACTAGAGGCGTTACGCTATATTCCTTTCTATGAACAACAACATTCGCATAATGAGTCATTACTTAAACTTGCCAAGTT...

Protein

Download Protein FASTA

402 aa · TkA04G038490|TK1151|PROTEIN

MLELYEATYLRVEGEVILDDALVFTRSRLNDISKDTLFGNSTLSIKIQAALKQPIRKRMPRLEALRYIPFYEQQHSHNESLLKLAKLGFNLLQSLHKKELSHVSKWWNGLDVPNNLPYARDRVVECYFWAVCVCHEPQDSNARVFLAKVICMQTLIDDTYDSYGIYEELEMFTEAIKRWSISCLDVLPEYMKPIYQVIMDMYKEMEELLGREGKTYYAKEFMKMSVSAYMTEAKWLHEGYIPTKEEHMSVSILNSGCSQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G038490`
TK1151 ID	TkA04G038490
OH-1004 ID	LXL04_036529
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 74.040 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G038490`
Location	Chr04:10316893-10326390 (+)
Description	Similar to CarS: E-beta-caryophyllene synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036529` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016102 diterpenoid biosynthetic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0034005 germacrene-A synthase activity Molecular Function GO:0080016 (-)-E-beta-caryophyllene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAL79181 ag:AFM43735 ag:AMP42991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770

Rank 1 · TkA04G038490 · TK1151

Nucleus0.168

Rank 2 · TkA04G038490 · TK1151

Plastid0.107

Rank 3 · TkA04G038490 · TK1151

Endoplasmic reticulum0.064

Rank 4 · TkA04G038490 · TK1151

Peroxisome0.056

Rank 5 · TkA04G038490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397Terpene_synth1-51 aa

PF11050Viral_env_E2673-104 aa

PF03936Terpene_synth_C110-344 aa

PF19086Terpene_syn_C_2148-344 aa

PF09635MetRS-N293-341 aa

PF11050Viral_env_E26309-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G038490	`PF01397`	Terpene_synth	1	51	3.5e-08	34.1
TkA04G038490	`PF11050`	Viral_env_E26	73	104	0.44	10.6
TkA04G038490	`PF03936`	Terpene_synth_C	110	344	2.6e-85	286.3
TkA04G038490	`PF19086`	Terpene_syn_C_2	148	344	1.3e-50	172.7
TkA04G038490	`PF09635`	MetRS-N	293	341	0.11	13.7
TkA04G038490	`PF11050`	Viral_env_E26	309	347	0.44	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card