RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G029460
Reference: TK1151 Chr: Chr04 Coordinates: 7778330-7779299 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

564 bp · TkA04G029460|TK1151|cDNA

ATGGGGGAAGTAAGGCATCTTGGGACTGCCGCGAGTTCATTTGTTAACAGGGTTCAGTTCGTATTTAACCTCAAATCTATCAAGTACGAGTTCATCGAGGAAAATCTGGAATGCAAAAGCAAGCTCTTATTGACATCAAACCCAGTTTTAAAGAAAGTTCCCGTTCTTTTGCAAGCAAACGAACCGCCAATTTGTGAGTCTTTAATCATCATCGAGTACCTGGACGAGAACCAGCCTGATGTCCACCCGATCCTTCCACT...

CDS

Download CDS FASTA

564 bp · TkA04G029460|TK1151|CDS

ATGGGGGAAGTAAGGCATCTTGGGACTGCCGCGAGTTCATTTGTTAACAGGGTTCAGTTCGTATTTAACCTCAAATCTATCAAGTACGAGTTCATCGAGGAAAATCTGGAATGCAAAAGCAAGCTCTTATTGACATCAAACCCAGTTTTAAAGAAAGTTCCCGTTCTTTTGCAAGCAAACGAACCGCCAATTTGTGAGTCTTTAATCATCATCGAGTACCTGGACGAGAACCAGCCTGATGTCCACCCGATCCTTCCACT...

Protein

Download Protein FASTA

187 aa · TkA04G029460|TK1151|PROTEIN

MGEVRHLGTAASSFVNRVQFVFNLKSIKYEFIEENLECKSKLLLTSNPVLKKVPVLLQANEPPICESLIIIEYLDENQPDVHPILPLVPSDQANNKFWANYVDHEFFPLFLELVHVQEKEAVKDKIMEGSQLLEEVFVKFSNGKAYFGGDDIGYLDVVLGCFLGWTKFLGKLNEFKVFDEVRTPKLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G029460
TK1151 IDTkA04G029460
OH-1004 IDLXL04_025221
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)66.500
Protein coverage (%)TK1151 97.326 / OH-1004 94.388
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G029460
LocationChr04:7778330-7779299 (-)
DescriptionSimilar to GSTU17: Glutathione S-transferase U17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g10370 Involved in light signaling, mainly phyA-mediated photomorphogenesis and in the integration of various phytohormone signals to modulate various aspects of plant development by affecting glutathione pools.
A glutathione S-transferase regulated by light and hormones participates in the modulation of Arabidopsis seedling development.2010 · DOI: 10.1104/pp.110.159152
At1g10360 May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides. No verified direct reference in this release
At1g59670 May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides. No verified direct reference in this release
At1g59700 May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0530900 Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006749 glutathione metabolic process Biological Process
GO:0009407 toxin catabolic process Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009704 de-etiolation Biological Process
GO:0048527 lateral root development Biological Process
GO:0060416 response to growth hormone Biological Process
GO:0080148 negative regulation of response to water deprivation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004364 glutathione transferase activity Molecular Function
KEGG gene cross-reference
ath:AT1G10360
ath:AT1G10370
ath:AT1G59670
ath:AT1G59700
dosa:Os10g0530900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.810
Rank 1 · TkA04G029460 · TK1151
Nucleus0.209
Rank 2 · TkA04G029460 · TK1151
Endoplasmic reticulum0.075
Rank 3 · TkA04G029460 · TK1151
Peroxisome0.051
Rank 4 · TkA04G029460 · TK1151
Mitochondrion0.048
Rank 5 · TkA04G029460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13417GST_N_39-80 aa
PF02798GST_N11-76 aa
PF13409GST_N_211-76 aa
PF03525Meiotic_rec11414-37 aa
PF03909BSD40-52 aa
PF17172GST_N_451-109 aa
PF10568Tom3751-119 aa
PF03909BSD87-102 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G029460PF13417GST_N_39809.2e-1245.8
TkA04G029460PF02798GST_N11763.2e-1040.9
TkA04G029460PF13409GST_N_211761.9e-0835.5
TkA04G029460PF03525Meiotic_rec11414370.1712.7
TkA04G029460PF03909BSD40520.08313.6
TkA04G029460PF17172GST_N_4511090.08414.3
TkA04G029460PF10568Tom37511190.2512.4
TkA04G029460PF03909BSD871020.08313.6
TkA04G029460PF03525Meiotic_rec114891400.1712.7
TkA04G029460PF00043GST_C1161690.008917.0
TkA04G029460PF22041GST_C_71171690.002518.4
TkA04G029460PF13410GST_C_21181713.6e-0524.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FUS8Arabidopsis thalianasp|Q9FUS8|GSTUH_ARATH Glutathione S-transferase U1745.500%Swiss-ProtMedium
Q9FUS9Arabidopsis thalianasp|Q9FUS9|GSTUI_ARATH Glutathione S-transferase U1843.900%Swiss-ProtMedium
Q9LQ48Arabidopsis thalianasp|Q9LQ48|GSTUF_ARATH Glutathione S-transferase U1542.300%Swiss-ProtMedium
Q9XIF8Arabidopsis thalianasp|Q9XIF8|GSTUG_ARATH Glutathione S-transferase U1644.000%Swiss-ProtMedium
Q06398Oryza sativa subsp. japonicasp|Q06398|GSTU6_ORYSJ Probable glutathione S-transferase GSTU642.300%Swiss-ProtMedium

JBrowse

View in Genome Browser