TkA04G029420 | RubberDandelionOmics

Gene overview

TkA04G029420

Reference: TK1151 Chr: Chr04 Coordinates: 7762550-7765413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1445 bp · TkA04G029420|TK1151|cDNA

CGCATATATCATCAAAGATACATCTATTCAAACATGTTCTGTCATTCATCACCCACTTTGCCTCCATCTTCTTTCTTTTAAATCATCTTCATCCATCGTTTCATAATTTGGAGACGAAATAGATGCTCAAGATGATACCCATGATGAAATTACTAGTTAATCTTCCATTTTTGTTGATTTTAGCAACTAATCATCTTTCACTACATATGATCCACGGACAACCCCAAGATTCATGTGGTTCAAACTCAAATCTTGCTAAT...

CDS

Download CDS FASTA

1140 bp · TkA04G029420|TK1151|CDS

ATGCTCAAGATGATACCCATGATGAAATTACTAGTTAATCTTCCATTTTTGTTGATTTTAGCAACTAATCATCTTTCACTACATATGATCCACGGACAACCCCAAGATTCATGTGGTTCAAACTCAAATCTTGCTAATATCAGTAGCCAGATCTTCTTTGAGACTTCTTCTCTCAATTGCTTTCCTGTTTGGTCTTCGGAAAACTTCATCCTTAGATATTCACAAGATGGCCCAAGTTTGTGGAATTTTGTCTTATCTGC...

Protein

Download Protein FASTA

379 aa · TkA04G029420|TK1151|PROTEIN

MLKMIPMMKLLVNLPFLLILATNHLSLHMIHGQPQDSCGSNSNLANISSQIFFETSSLNCFPVWSSENFILRYSQDGPSLWNFVLSAPISNSYIGMGFSPNGGMVGSSAVVGWVARDGSGNMKKYFLGGQSPSQVLVDQGDLEIIGNTSLVISDSSRIFMVFQLVIDQPRRQLVFSVGDSSNPPPNTPNFLLTRHRSHMAISLNYASGQSSRIKAPYSNLKRAHGTLNMIGWGILIPIGAMVARYLKHLNPLWFYIHTGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G029420`
TK1151 ID	TkA04G029420
OH-1004 ID	LXL04_036683
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G029420

Location Chr04:7762550-7765413 (+)

Description Similar to At3g07570: Cytochrome b561 and DOMON domain-containing protein At3g07570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07570`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g61750`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g59070`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At5g35735`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At4g17280`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036683 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080022 primary root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G07570

ath:AT3G59070

ath:AT3G61750

ath:AT5G35735

ath:AT5G47530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.637

Rank 1 · TkA04G029420 · TK1151

Lysosome / Vacuole0.182

Rank 2 · TkA04G029420 · TK1151

Cytoplasm0.122

Rank 3 · TkA04G029420 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA04G029420 · TK1151

Golgi apparatus0.060

Rank 5 · TkA04G029420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01794Ferric_reduct17-36 aa

PF29747TP_078365-135 aa

PF03351DOMON83-135 aa

PF01794Ferric_reduct198-259 aa

PF03188Cytochrom_B561224-344 aa

PF19589DUF6095229-244 aa

PF29747TP_0783237-276 aa

PF19589DUF6095259-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G029420	`PF01794`	Ferric_reduct	17	36	0.65	10.8
TkA04G029420	`PF29747`	TP_0783	65	135	0.074	12.5
TkA04G029420	`PF03351`	DOMON	83	135	2.7e-08	34.8
TkA04G029420	`PF01794`	Ferric_reduct	198	259	0.65	10.8
TkA04G029420	`PF03188`	Cytochrom_B561	224	344	2.8e-06	28.4
TkA04G029420	`PF19589`	DUF6095	229	244	0.71	10.8
TkA04G029420	`PF29747`	TP_0783	237	276	0.074	12.5
TkA04G029420	`PF19589`	DUF6095	259	304	0.71	10.8
TkA04G029420	`PF01794`	Ferric_reduct	298	338	0.65	10.8
TkA04G029420	`PF19589`	DUF6095	317	345	0.71	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRW8`	Arabidopsis thaliana	sp\|Q0WRW8\|B561K_ARATH Cytochrome b561 and DOMON domain-containing protein At3g07570	51.300%	Swiss-Prot	High
`Q9M363`	Arabidopsis thaliana	sp\|Q9M363\|B561I_ARATH Cytochrome b561 and DOMON domain-containing protein At3g61750	40.000%	Swiss-Prot	Medium
`Q9LYS9`	Arabidopsis thaliana	sp\|Q9LYS9\|B561H_ARATH Cytochrome b561 and DOMON domain-containing protein At3g59070	30.000%	Swiss-Prot	Medium
`Q9FKH6`	Arabidopsis thaliana	sp\|Q9FKH6\|B561P_ARATH Cytochrome b561 and DOMON domain-containing protein At5g35735	30.600%	Swiss-Prot	Medium
`Q8VYH6`	Arabidopsis thaliana	sp\|Q8VYH6\|B651B_ARATH Cytochrome b561 and DOMON domain-containing protein At4g17280	28.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card